SecReT6
Effector Protein ID: 537457008
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_16725
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]471403..471921 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDT1Y3C6
KEGG IDlag:N175_16725
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-35, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|537457008|ref|YP_008489652.1| hypothetical protein N175_16725 [Listonella anguillarum M3]
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTTLESASIVDIHCEMPHCQDPANGDFTQ
NVTVSMSYRKILWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|537456627|ref|NC_022224.1|:c471921-471403 Listonella anguillarum M3 chromosome 2, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCGAAACTCAGGGCCTGATCACTGCTGGTGCTCTGTCTA
CTGATTCAATCGGTGATGCGTTCGTTGAAGGTCATGAAGACCAAATGTTGGTTCAACAATTTGACCACGT
TGTAACTGTACCGACTGATCCACAATCAGGTCAGCCTTCTGGTCAACGTGTTCACAAACCATTTAAATTC
ACCGTAGCGCTAAACAAAGCGGTTCCTCTTCTTTATAACGCACTGGCGTCTGGCGAGAAGATGAAATCGG
TTGAGCTAAAATGGTACCGCACTTCTATCGAAGGTAAGCAAGAGAACTTCTTCACTACTACACTCGAAAG
CGCGTCTATCGTGGACATTCACTGTGAAATGCCACACTGCCAAGATCCAGCGAACGGCGACTTCACACAA
AACGTTACGGTTTCTATGTCTTACCGTAAAATCCTGTGGGATCACGTGAATGCGGGTACTTCAGGCTCTG
ACGACTGGCGCAAGCCTGTTGAAGCGTAA
 Primer design