SecReT6
Effector Protein ID: 537457295
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_18440
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022224] [Browse all T6SS(s) in this replicon]
Location [Strand]887463..889373 [+]
Productlipase
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDT1Y5Q9
KEGG IDlag:N175_18440
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.50E-19, Aligned region: 312..428
CarboxypepD_reg [PF13620], Evalue: 0.009, Aligned region: 24..94
Protein Sequence: 636 a.a.     [Download]
>gi|537457295|ref|YP_008489984.1| lipase [Listonella anguillarum M3]
MDSFNHCVQCNPEKNWLELEFMSENDEPIDGLAVTITNKITSNTHTQTTSAGKVLFANIAAGEWRASVSQ
ASLLSEVEKYASRKEGQESPVKIRASAELDAAEQNPKRYHSTTIGDFWDEAPQDEFLQEHHKGIDTNASA
EKAGFSLSHNQSYVFEIKALRSYMPVIIDTDEFSLVNSYTFALLSKLAYATDKKSIDLKSEADSTGSIGT
VINQFKSRQLPIQSGNQKVRWLVEEIPYSRALNFKYYDNRQKHAQGYILFNEEIAIVSVRGTEPSFYDKD
SVIDPNSKFIITKVANGIDAVLNSPGINDLVKTDLDAAQIAPNEFGGAYVHQGFYQYSMALWENTLLADD
ILKNHATKRFYLCGHSLGGAGALLLSALIKDSLHPSVLRLYTYGMPRTGTRSFVTQYQDILHYRHVNNHD
GVAQIPMTWANTDITEGLDKWDVFSSGITLIKKMLTDNDDDNYLHHGHLSQLLTYQKPDQILLTPRQTQV
TMLDMAKLAINDSVSLVNNLSEVSIAEHGMDHYVPNLWQQLLALSNESLMTHYQKAISALDQEIATLQQN
YLTVKQTWARSIGDGTPAMGIGRLMSEMNSINKLIDNRNQIRGELKQIVSDPQRLPLAKLLIAQQTLPDE
IKEQLQ
-
Nucleotide Sequence: 1911 bp     [Download]
>gi|537456627|ref|NC_022224.1|:887463-889373 Listonella anguillarum M3 chromosome 2, complete sequence
ATGGATTCATTTAACCATTGCGTGCAGTGCAACCCCGAGAAAAACTGGTTGGAACTGGAGTTCATGAGTG
AAAACGATGAACCGATTGATGGCCTTGCCGTCACCATTACGAACAAAATTACCTCCAACACACACACGCA
AACCACCAGCGCCGGTAAAGTATTATTTGCAAATATTGCCGCAGGTGAATGGCGCGCTTCTGTCAGCCAA
GCCTCTTTGTTAAGCGAAGTCGAAAAGTACGCCAGCCGTAAAGAAGGGCAAGAGTCGCCAGTGAAAATCC
GTGCATCGGCAGAGCTGGATGCTGCTGAGCAAAACCCGAAACGGTATCACAGCACCACCATAGGTGATTT
TTGGGATGAAGCCCCGCAAGATGAGTTTTTACAAGAGCATCATAAAGGGATAGATACCAATGCCTCTGCG
GAAAAAGCAGGGTTCAGCCTTAGCCACAACCAAAGTTACGTTTTCGAAATCAAAGCACTGCGCAGTTATA
TGCCAGTGATTATTGATACCGATGAATTTAGTTTGGTGAATAGTTATACCTTTGCGTTGTTGTCCAAATT
AGCTTATGCGACTGATAAAAAAAGTATTGATCTAAAATCAGAGGCTGACAGTACTGGGAGTATCGGAACA
GTTATAAATCAGTTCAAGTCTAGGCAGTTGCCGATACAGTCAGGTAATCAAAAAGTGAGATGGCTTGTCG
AGGAAATACCTTACAGCAGAGCGCTGAATTTTAAATACTACGATAACCGCCAGAAACATGCCCAAGGCTA
TATCCTGTTCAATGAAGAAATAGCTATTGTTTCAGTTAGAGGTACTGAGCCGAGTTTTTACGATAAAGAT
AGTGTCATTGATCCAAATTCAAAATTCATCATTACTAAAGTGGCTAACGGCATTGACGCTGTACTTAATT
CGCCAGGTATAAATGACCTTGTTAAAACAGACTTGGATGCAGCACAAATAGCGCCTAATGAATTTGGAGG
GGCCTATGTCCATCAGGGGTTCTATCAATATTCGATGGCGTTATGGGAAAACACACTACTAGCTGATGAT
ATTTTAAAAAACCATGCTACTAAACGATTTTATCTTTGTGGGCATAGTTTAGGTGGTGCTGGGGCATTGC
TGCTCAGTGCATTGATTAAAGATAGCCTCCATCCTTCAGTATTGCGTTTATATACATATGGAATGCCACG
GACAGGAACGCGCAGTTTTGTTACCCAGTATCAGGATATTCTGCATTATCGTCATGTTAATAACCATGAT
GGAGTTGCTCAAATCCCCATGACATGGGCAAATACCGATATTACAGAAGGACTCGATAAATGGGATGTAT
TTAGTAGCGGTATAACGTTGATTAAGAAAATGCTCACCGATAACGACGATGATAATTATCTGCACCATGG
TCATTTATCACAGCTACTGACTTATCAAAAACCAGATCAGATTCTACTAACGCCCAGACAAACACAAGTG
ACGATGTTAGACATGGCAAAATTAGCCATTAATGATTCTGTTTCGCTGGTAAATAATTTGTCCGAAGTAT
CGATTGCTGAGCACGGTATGGATCATTATGTACCTAACTTATGGCAACAGCTGCTTGCTTTAAGTAATGA
AAGTTTAATGACGCATTATCAAAAAGCGATATCAGCTCTCGATCAAGAAATTGCTACTTTACAGCAAAAT
TATCTCACCGTTAAACAAACTTGGGCTCGTTCTATCGGAGATGGCACACCTGCTATGGGAATTGGACGTT
TGATGAGCGAGATGAATTCTATAAATAAGTTAATAGATAACCGTAATCAGATTAGAGGTGAACTAAAGCA
GATAGTCTCTGATCCTCAGCGCTTACCTTTAGCAAAATTATTAATAGCGCAGCAAACATTACCTGATGAA
ATCAAGGAACAACTGCAATGA
 Primer design