SecReT6
Effector Protein ID: 543974104
SecReT6 ID848
T6SS typeA1
Gene symbol-
Locus tagN646_3973
StrainVibrio alginolyticus NBRC 15630 = ATCC 17749
Repliconchromosome II [GenBank: NC_022359] [Browse all T6SS(s) in this replicon]
Location [Strand]966937..968589 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1388
DescriptionVP1388
UniProt IDT2C2N1
KEGG IDvag:N646_3973
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 550 a.a.     [Download]
>gi|543974104|ref|YP_008548850.1| hypothetical protein N646_3973 [Vibrio alginolyticus NBRC 15630 = ATCC 17749]
MRNSDDILRNLPKELAQKISISAKKTTSALLAAIRIELGKGNWVSLSTVARRSPLTDSQLQSFPRLKSLV
DSVSASNESKAFKAGYKQVTDDVALVRSYTHVPSEPSLDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVT
VGKADTENKHRSLAIFKDLEAEGKTLYIKIPCTDQPQPILLKLAENLQPVGKDTQMDEWDNVLVPVVPLH
FPSSDKSDEAAEVFKSGYVYVVWNNKIWREVAITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVF
AYEPFQIVQNGKVVSEGSLNGSGEARVFNLVEEEVEIVMTGYEPQIKEKIETNLSPINASSPVERSAQGY
PLPHIWLPYKIKGEPQEVYLAYNSKRLSESELSELESDPGTKAIKVTDLNHYSSEKSFKIGDGSVRLLSV
LPSAATSKPEKYAMLRSQLNKNVAVVYLLKSVEIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCI
KKENGSRLIRFTGWPAEVKEVDLLRGYQGNSHHGRDNKTVIFAQTPIADLLAYKKKDQPS
-
Nucleotide Sequence: 1653 bp     [Download]
>gi|543973209|ref|NC_022359.1|:966937-968589 Vibrio alginolyticus NBRC 15630 = ATCC 17749 chromosome 2, complete sequence
TTGCGAAATTCAGATGACATCCTTAGAAACCTCCCTAAAGAGTTGGCGCAAAAGATTTCCATCTCTGCCA
AAAAAACGACCAGCGCATTGCTAGCTGCTATAAGAATCGAATTGGGAAAAGGCAATTGGGTGTCATTATC
TACCGTTGCTCGTCGGTCGCCATTGACGGACTCTCAGCTGCAAAGCTTCCCTAGACTTAAATCACTCGTT
GACTCTGTATCTGCTTCGAATGAAAGCAAAGCTTTTAAAGCAGGATACAAGCAGGTTACCGACGATGTTG
CTTTAGTTCGTAGTTACACGCATGTCCCCTCTGAGCCAAGTCTAGATCAAAAAATCGTTGTCGAGTTTGC
AGGGCAGTGGTCTAGCAACGCGGCATGTTTGATGTTGGGAAAAACCGAAGCTCAAAAAGAAAAAGTGACT
GTAGGCAAGGCTGATACAGAAAACAAACACCGCAGCCTCGCGATATTTAAAGATCTCGAAGCTGAGGGCA
AAACGCTCTATATCAAGATCCCTTGCACTGACCAGCCTCAGCCAATTTTGCTTAAACTCGCCGAAAACCT
GCAACCCGTTGGTAAAGATACTCAGATGGATGAGTGGGATAACGTGTTGGTGCCTGTGGTTCCGCTGCAC
TTCCCTAGTAGCGATAAATCAGATGAAGCTGCAGAAGTGTTTAAATCAGGCTACGTGTATGTTGTTTGGA
ACAATAAAATTTGGCGCGAAGTGGCAATTACGGAAAATGGTTACTTTTCAGATACGGACATTAATAGTGT
TCGTGAAGGCTCTAGACCCAAAAGGCACGCCGATATCTATATGACCAATCCTGAAACAGGCGGTGTTTTC
GCTTATGAGCCTTTCCAAATCGTGCAGAACGGCAAGGTGGTAAGTGAAGGCTCTTTGAATGGCTCTGGAG
AGGCTCGAGTGTTCAACTTAGTTGAGGAAGAAGTTGAGATAGTCATGACAGGCTATGAACCACAAATCAA
AGAAAAGATTGAAACAAATTTGAGCCCTATTAATGCTTCTAGCCCAGTGGAGCGGAGCGCGCAAGGTTAC
CCTCTCCCGCATATATGGCTTCCTTACAAGATTAAAGGTGAGCCTCAAGAAGTATATTTGGCTTATAACA
GTAAACGATTGAGCGAGAGTGAACTATCTGAACTAGAAAGTGATCCCGGAACCAAGGCCATAAAAGTCAC
TGATCTTAACCATTATAGCAGTGAGAAAAGCTTTAAAATTGGAGACGGTTCTGTTCGTCTGCTCTCAGTA
TTACCAAGTGCTGCGACCTCAAAACCTGAAAAATACGCAATGTTACGAAGCCAGCTAAATAAAAATGTAG
CGGTCGTGTATTTACTTAAATCTGTCGAGATAGTTTTCGAATATCCGGGCTATACGACGCTGGACGAGTC
AGATGATTACTTTGAGTTAAGGCAAAGCGATGGTGATTGGTCGCAGCGAGTGTGCTTGCGCCAATGTATA
AAAAAAGAGAATGGTTCTAGGTTGATTCGTTTTACTGGTTGGCCTGCAGAGGTTAAAGAAGTGGATCTTC
TCCGTGGTTATCAGGGCAATAGTCATCACGGAAGAGATAATAAAACGGTCATTTTTGCTCAAACACCCAT
TGCGGATTTACTGGCTTACAAGAAAAAAGATCAGCCAAGTTAA
 Primer design