SecReT6
Effector Protein ID: 544577337
SecReT6 ID853
T6SS typeA2
Gene symbolhcpA_3
Locus tagECOPMV1_03080
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3150723..3151214 [+]
ProductSecreted protein hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDT2MV92
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|544577337|ref|YP_008572861.1| Secreted protein hcp [Escherichia coli PMV-1]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3150723-3151214 Escherichia coli PMV-1 main chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGATAACGTCAAGCTGGTCAGAGTAGCTCCGCT
GATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA
 Primer design