SecReT6
Effector Protein ID: 544577340
SecReT6 ID853
T6SS typeA2
Gene symbol-
Locus tagECOPMV1_03083
StrainEscherichia coli PMV-1
Repliconchromosome [GenBank: NC_022370] [Browse all T6SS(s) in this replicon]
Location [Strand]3156563..3158332 [+]
ProductPGAP1-like protein
Effector typeProtein
Homologous effectorAHW84487
DescriptionTle4
UniProt IDT2MUB2
KEGG IDecoi:ECOPMV1_03083
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 8.40E-05, Aligned region: 245..296
LCAT [PF02450], Evalue: 8.40E-05, Aligned region: 383..424
LCAT [PF02450], Evalue: 8.40E-05, Aligned region: 526..565
Abhydrolase_6 [PF12697], Evalue: 0.0028, Aligned region: 240..272
Protein Sequence: 589 a.a.     [Download]
>gi|544577340|ref|YP_008572864.1| PGAP1-like protein [Escherichia coli PMV-1]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMEKKSDISLEPKFIDGRLDLNEVGNIR
TIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD
-
Nucleotide Sequence: 1770 bp     [Download]
>gi|544574430|ref|NC_022370.1|:3156563-3158332 Escherichia coli PMV-1 main chromosome, complete genome
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATAC
TTCATTAAATCAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAAT
CCATTTCATAAGCAAATTGCTGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGG
GAGATATTCCTGAAGCGCATTTAACGCAGGAAAATGTTCTTTGGAAAGGCTCATTATCAATGGAAAAAAA
AAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGTCTTGATTTAAATGAAGTTGGTAACATTAGA
ACTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATACTGACGACGGTGATACATATG
TTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTACCTCTTCGTGC
AGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTA
AAATGTCATACTCTGATTAA
 Primer design