SecReT6
Effector Protein ID: 549688978
SecReT6 ID855
T6SS typeA5
Gene symbol-
Locus tagVIBNI_A1443
StrainVibrio nigripulchritudo str. SFn1
Repliconchromosome [GenBank: NC_022528] [Browse all T6SS(s) in this replicon]
Location [Strand]1545381..1545860 [+]
Productputative Virulence factor, secretion apparatus
Effector typeProtein
Homologous effectorVPA1027
DescriptionHcp protein
UniProt IDU4JXB8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|549688978|ref|YP_008620710.1| putative Virulence factor, secretion apparatus [Vibrio nigripulchritudo]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREITSYTGTAQDREASSTRLYDLTITKLQDRASPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYAVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTVAPLVYGYSGVKGQQM
-
Nucleotide Sequence: 480 bp     [Download]
>gi|549687642|ref|NC_022528.1|:1545381-1545860 Vibrio nigripulchritudo str. SFn1 chromosome, complete genome
ATGCAGTCAAATACATACCTTAAATACGCTGATATTAAAGGTGAAGCTACTGCTGAGCAGTACAAGGATC
TGATCACTCTACTTTCTGTTGATTGGAGCGTTGGTCGTGAAATTACTTCTTACACTGGTACAGCACAAGA
CCGTGAAGCAAGTTCTACTCGTCTTTACGACTTGACTATTACTAAACTTCAAGACCGTGCTTCTCCAGAC
CTGTTCAAAGAAGCGACTATCGGTAAAGGTAAGCCAGCTGTTTTCCACATCACTAAGCAAGGTGAAAAAG
TGGAAGAAATCATGAAGATCGAACTAACTGATGCAATGATTTCTAACTACGCTGTGTCTATCCAAGACGA
CCGTCCAGTTGAAACAATCACTATTTCTTACACTGAAATGATGATGACTGTTACTCCAACTGACGACAAG
AACAACACTGTTGCTCCTCTTGTTTACGGTTACAGCGGCGTTAAAGGTCAGCAAATGTAA
 Primer design