SecReT6
Effector Protein ID: 558666446
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0488
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]602419..606372 [-]
ProductRhs family protein
Effector typeProtein
Homologous effectorPA2684
DescriptionTse5
UniProt IDU6AQX7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 198..220
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 274..290
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 320..338
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 343..361
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 381..415
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 426..461
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 472..500
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 489..524
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 574..609
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 615..642
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 636..670
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 685..709
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 703..740
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 767..778
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 816..834
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 821..855
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 842..870
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 924..942
RHS_repeat [PF05593], Evalue: 6.00E-56, Aligned region: 948..981
RHS [PF03527], Evalue: 4.00E-16, Aligned region: 497..516
RHS [PF03527], Evalue: 4.00E-16, Aligned region: 1065..1104
Protein Sequence: 1317 a.a.     [Download]
>gi|558666446|ref|YP_008803156.1| Rhs family protein [Pseudomonas aeruginosa PA1R]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPD
TFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRR
GGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGL
LTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIA
VRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLG
RVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNVTTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWN
RFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAKGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGR
RQRYRYNAADELIAREDADGRETTYGYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVR
YTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERD
ALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEYAREDARQAFAENELYRSGFSRSEARASQAGEGPA
RWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRI
AKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQ
PLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLCWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGA
GIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3954 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c606372-602419 Pseudomonas aeruginosa PA1R, complete genome
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTTATCTCCACCGGCTCGCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAA
GCCGGTCAACCCGATGCTCGGCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGTGGCTACCTGTCGAGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGC
TGCCGGGCGAGAGCATGCACCTGGAACTGAGCGAAGACGCCTGCGTGCTGGTCGACGCCCAGGGCCGCCG
GATCGGCTTTCCTGCGCTGGCTCCCGGCGCGCAGCATTATTCCGGCAGCGAGGAGCTGTGGCTGCGCCGC
GGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCCGAACTGCAGA
CGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTG
CTCACCGGCGTGCGCGACAGCGCCGGGCGCAGCTATGCGCTGGTCTACCAGCAGGCCTGCGAGCCGAGCG
AGGGCGACGACGGCCTGCGTCTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACAT
CGATCCGCAGAGCCCGGGGCTCGACTGGCTGGTGCGCTACCAGTTCAGCGACAGCGGCGACCTGATCGCC
GTGCGCGACCGTCTTGGCCAGGTGGTCCGGGTATTCGCCTGGCGCGAGCACATGCTGGTCGCCCACGGCG
AACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCACGGGCGGGTCGTGAAGCAGAT
CGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGCCTCGGC
CGCGTCGAACGCTACGAGTTCGCCGGCGAGGGTGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGATCCGCTGGGACGGGA
GACGCGGCGCCGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGC
AAGCGCGTCGACGAAGAGACCGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCG
AGCGCGACGAACGGGGCAATGTGACGACGGTGCGCGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGA
CCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCGCGCGGCGGCGAGCGGCGCCTGGAGTGGAAC
CGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCGTTACGACTACGACAACGAAG
GACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGCTGGGGCAACT
GATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGCGGCAGACCCGT
ATCGCCGATGCCAAGGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGCGCGGGTTTCCG
ACGCCGGCGGCGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAA
CGGCGTCCAGGCGCAGTTCCGCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGT
CGCCAACGCTATCGCTACAACGCCGCTGACGAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCA
CCTATGGCTACGACCGCGACGGCCGCCTGGCGAGCATCCGGGTTCCCGCCACCGAGCACGCACCGGCCCT
GGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCGGGGCGGATTGCGAGGTGCGC
TACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGGGTCTACAGCG
TCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGAT
GCCCTGCACCGCGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGC
GCCAGCACGCGCCGCTGGGACGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCG
CGGCTATCGCTACGACGGACTTGGACAACTGGTCGGCATCGACGACAACCAGTATCCGTCGGTGCGCTAC
GAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCGCTGGCGCGGCGGCCAGCACCTACCGCTACG
ACGCCGCCGGCAACCGCCTGGAGGGCGTTGGCGAGTACGCGCGCGAGGACGCTCGCCAGGCATTCGCCGA
GAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGGCGCGCGCGAGCCAGGCCGGCGAAGGCCCGGCG
CGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCT
GACGCGCGATTACGCCGACGGCACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATC
GCCAAGGTGGTGCTGCGCGACGGTGTCGAGCAGCAGGTGCGCTTCGGCTGGGACGGCGATCGCCAATGCG
CCGAAGCCTTTGCGCGGGAACTGCGCACCACCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCT
GGAGCAGGCCTGCGAGCCCGATCCCCCGGAGCTGCTGCAACTGCGCCAGGCGTTCGCCGCCGAAGGCCAG
CCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTTCTTCCACACCGATCACCTCG
GTACCCCCCTGCAACTGAGCGACGAACGTGGCCAACTGTGTTGGCAGGGCGTTCCGGACGACTGGCGGGC
GGTGGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGACGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTACTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGATCCGCTCG
GCCTGGGCGGTGGGCCCAACCCCTATGCCTACGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGG
CCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCC
GGCATCGAGCTGGGGATGCAGACCGGCAAGCAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATC
GCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAACTGGAAACACGTCGGCGCCTCGGCGGCCAT
CGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGTCCGCCAAGGCGATCAGGACC
CTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCCCATGCCG
ATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCGCT
GAAGGACGAAGAAGAGGAGTGTCCGCCGCAATGA
 Primer design