SecReT6
Effector Protein ID: 558666447
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0489
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]606422..608491 [-]
ProductVgrG protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDU6ARB9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-86, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 2.70E-86, Aligned region: 347..394
Phage_base_V [PF04717], Evalue: 6.70E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 529..551
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 553..575
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 605..615
Gp5_C [PF06715], Evalue: 9.80E-09, Aligned region: 620..634
DUF2345 [PF10106], Evalue: 7.10E-05, Aligned region: 646..683
Protein Sequence: 689 a.a.     [Download]
>gi|558666447|ref|YP_008803157.1| VgrG protein [Pseudomonas aeruginosa PA1R]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRER
DHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIE
AIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCI
DAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAERNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVD
RNETVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVS
VGGSDDGSKITLDGRSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2070 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c608491-606422 Pseudomonas aeruginosa PA1R, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAATACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAAC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGG
CGCGCACCACAGCCCGGCCGGCTACACCAGCGTGCCCTACTACCCGCCGAGCCTCGGCCATCGCGAGCGC
GACCACTTCTTCGACTGGCACATGGCGCGTGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCACCCGCCTGGAAGTGCGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCC
GCTCTACGACTACCCTGGCGAGTATGTGCAGAGTCAGGACGGCGAACACTATGCACGGACCCGCATCGAG
GCGATCCAGACCCAGTACGAGCGAGTTCGCCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGT
TCCACCTGAGCAACTACCCGCGCCTGGACCAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGT
AGTCCAGGAACTCTACGAGACCGGTAATGGCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATC
GACGCCGGCCAGGCTTTCCGCCCCTTGCCGTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCATTTCCATTG
GGACCGCCACGACCAGTCCAACGAGAACAGCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATCCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
TACCCAGAGCGGCACCAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGAC
CGCAACGAGACGGTCAGGATCGGCATGAACAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCG
GCATGGGGCGCATGGAAAACGTCGGGCTCGGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGT
CGGGCTGAACCAGAGCACCCAGGTGATGAAGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGC
GTGGGCGGCAGCGACGATGGCTCGAAGATCACCCTGGACGGCCGGAGCATCACCCTCGGCAGCCAGCGCA
TCGAGCTGACCGCCGACCGCGAGATCCTCTTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGA
GATCGAGATCCTCTCGCCCAATGTCGATATCAACTGTTGA
 Primer design