SecReT6
Effector Protein ID: 558666449
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0491
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]609195..610487 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorPA0093
DescriptionTse6
UniProt IDU6AZM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Toxin_61 [PF15538], Evalue: 3.30E-75, Aligned region: 266..422
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 1.10E-14, Aligned region: 78..153
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 84..104
DUF4150 [PF13665], Evalue: 0.006, Aligned region: 125..146
Protein Sequence: 430 a.a.     [Download]
>gi|558666449|ref|YP_008803159.1| Rhs family protein [Pseudomonas aeruginosa PA1R]
MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIVKGLT
TIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIAEGSATVYINGKPAAR
LQSKMVCGAHIKTGSQDTFIGGPTERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAI
GGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMALLGFGPKLAGRRPAAVTSETAQRRAYLNNKFGRSGNL
DHDINYRGNRETAAKFFKSKDIDPADAESYMNGLDFNHPVRVETLAPGKNLWQYQSPGAPQGNWYTLSPR
VQPTELGINPMGTNRAANTIEPKVLNSYRTTQKVEVLRSTAAPTDDFWSVKGQSYPAKGGAQQLFSNEKG
SFGLLPREGS
-
Nucleotide Sequence: 1293 bp     [Download]
>gi|558665962|ref|NC_022806.1|:609195-610487 Pseudomonas aeruginosa PA1R, complete genome
ATGGATGCGCAAGCCGCCGCCCGACTGGGCGATGAGATAGCCCACGGTTTCGGTGTCGCCGCGATGGTCG
CCGGAGCCGTGGCCGGAGCCCTGATCGGCGCCGCCGTGGTCGCCGCCACCGCCGCCACCGGCGGCCTGGC
CGCGGTGATCCTGGCCGGTTCGATCGCCGCTGGCGGGCTGTCGATGTTCCAGATCGTCAAGGGCCTGACC
ACCATCTTCGAGCTACCCGAGCCGACCACCGGGGTGCTCATACGCGGCAGCTTCAACGTCTATGTGAACA
GTCGCAACGCGATGCGCGCCGGCGACGACGTCTCCGCCACCTGCAGCGGCCTGCCGCTGAACCATCCGCT
GTGGCCGTTCCCGGTGCTGATCGCCGAAGGCAGCGCCACCGTGTACATCAACGGCAAGCCGGCGGCGCGC
CTGCAGAGCAAGATGGTCTGCGGCGCGCACATCAAGACCGGCAGCCAGGACACCTTCATCGGCGGCCCCA
CCGAGCGGGTGGCCTTCGTCCTCGACCTGGAGGAATGGCTGCACACCGGCCTCGAGGCGCTGGGCCTGGC
GGCCCTTGCCGGCGGCCTGCTGCTGGCGGCGATGGCCGGGGTCGCGGCGCTGGCCGGCTTCGTCGCCATC
GGCGGGCTGATGATGGGCGGCATGGCCCTGCTCGGCGACCTCGGCGACCGCCTCGGTCCCGGCTACCGCG
ACCTGTTCCAGGGCGTGGCGGGGATGGCATTGCTGGGCTTCGGGCCGAAACTCGCCGGTCGTCGTCCGGC
AGCGGTGACCTCCGAAACCGCGCAACGACGCGCCTACCTGAACAACAAGTTCGGTCGTTCCGGCAACCTC
GACCACGACATCAACTACCGCGGGAATCGTGAAACCGCCGCCAAGTTCTTCAAGTCGAAGGACATCGATC
CTGCCGATGCCGAGTCGTACATGAACGGCCTGGACTTCAACCATCCGGTCCGTGTGGAAACCCTCGCGCC
CGGCAAGAACCTGTGGCAGTACCAGTCCCCCGGAGCGCCGCAGGGCAACTGGTATACACTCAGCCCGCGC
GTGCAGCCCACGGAGCTGGGAATCAACCCCATGGGCACCAACCGGGCGGCGAACACCATCGAACCCAAGG
TCCTCAACTCCTACAGGACGACCCAGAAGGTCGAGGTCCTGCGCAGCACCGCTGCGCCGACCGATGACTT
CTGGTCGGTAAAGGGACAGTCATATCCCGCCAAAGGCGGCGCGCAACAACTGTTCTCCAACGAGAAAGGC
TCCTTCGGTCTGCTTCCCCGGGAGGGATCATGA
 Primer design