SecReT6
Effector Protein ID: 558666468
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp0510
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]631838..632314 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702
DescriptionTse2
UniProt IDU6APE9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|558666468|ref|YP_008803178.1| hypothetical protein PA1R_gp0510 [Pseudomonas aeruginosa PA1R]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLRPDQELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|558665962|ref|NC_022806.1|:631838-632314 Pseudomonas aeruginosa PA1R, complete genome
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCG
ACGTCGGTCGCTACCTGCGTCCCGACCAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAACACCCCTGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCTTAAGGTGAAACAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAACTG
GACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG
 Primer design