SecReT6
Effector Protein ID: 558667263
SecReT6 ID871
T6SS typeA3
Gene symbol-
Locus tagPA1R_gp1325
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]1489399..1490625 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3484
DescriptionTse3
UniProt IDU6ARN2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 408 a.a.     [Download]
>gi|558667263|ref|YP_008803973.1| hypothetical protein PA1R_gp1325 [Pseudomonas aeruginosa PA1R]
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGPPELARSLIA
SIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAI
QGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPI
STLFPDAYPGNPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFP
SIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
-
Nucleotide Sequence: 1227 bp     [Download]
>gi|558665962|ref|NC_022806.1|:1489399-1490625 Pseudomonas aeruginosa PA1R, complete genome
ATGACCGCCACCAGCGACCTGATCGAGTCACTGATTTCCTATAGCTGGGACGACTGGCAGGTGACCCGCC
AGGAAGCCCGCCGGGTGATCGCCGCGATCCGCAACGACAACGTGCCCGATGCGACCATCGCCGCACTCGA
CAAGAGCGGCTCGCTGATCAAGCTGTTCCAGCGGGTGGGCCCGCCGGAACTGGCGCGCTCGCTGATCGCC
AGCATCGCCGGGCGCACCACCATGCAGCGCTACCAGGCACGCAATGCCTTGATCCGCAGCCTGATCAACA
ATCCCCTGGGCACCCAGACCGACAACTGGATCTACTTCCCCACCATCACCTTCTTCGACATCTGCGCCGA
CCTCGCCGACGCCGCTGGCCGCCTGGGCTTCGCCGCGGCCGGCGCCACCGGGGTGGCCAGCCAGGCGATC
CAGGGTCCGTTCAGCGGGGTCGGCGCCACCGGCGTCAATCCGACCGACCTGCCGTCCATTGCCTTCGGCG
ACCAGCTCAAGCTGCTCAACAAGGACCCGGCGACCGTCACCAAGTACAGCAACCCGCTCGGCGACCTGGG
CGCCTACCTGAGCCAGCTTTCGCCGCAAGACAAGCTGAACCAGGCACAGACGCTGGTCGGCCAGCCGATC
AGCACGCTGTTCCCCGACGCCTATCCGGGCAACCCGCCGTCGCGGGCCAAGGTCATGTCCGCGGCCGCGC
GCAAGTACGACCTGACGCCGCAACTGATCGGCGCGATCATCCTCGCCGAGCAGCGTGACCAGACCCGCGA
CGAAGACGCCAAGGACTATCAGGCGGCAGTCAGCATCAAGAGCGCCAACACCTCCATCGGCCTCGGCCAG
GTGGTGGTCTCCACCGCGATCAAGTACGAGCTGTTCACCGACCTGCTCGGCCAGCCGGTGCGCCGCGGTC
TGTCGCGCAAGGCGGTCGCCACCCTGCTGGCTTCCGACGAATTCAACATCTTCGCCACCGCCCGTTACAT
CCGCTACGTCGCCAACCTCGCGTCGCAACAGGACCTGCGCAAGCTGCCGAAGACCCGCGGCGCATTTCCC
TCCATCGATCTCCGCGCCTACGCCGGCAATCCGCGCAACTGGCCGCGGGACAATGTCCGCGCGCTGGCCT
CGGAATACACCTCGCGGCCCTGGGACGACAACCTGTCGCCGGGCTGGCCGATGTTCGTCGACGATGCCTA
CGCCACCTTCCTCGACCCCGGAATGAGGTTCCCATGA
 Primer design