SecReT6
Effector Protein ID: 558669111
SecReT6 ID872
T6SS typeA1
Gene symbol-
Locus tagPA1R_gp3202
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]3580494..3581120 [-]
ProductSecreted protein Hcp
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDU6AYG2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-20, Aligned region: 6..93
Protein Sequence: 208 a.a.     [Download]
>gi|558669111|ref|YP_008805821.1| Secreted protein Hcp [Pseudomonas aeruginosa PA1R]
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPTGQRVHKPVVI
TKVFDKASPLLLAALTSGERLTKGDPVVPHLRRRHPGALLHHRPGRRDHRRHQGLHAQLPGPGQRPLHPP
GRRALHLPQDHLDPRSLRHLRLRRLALPGRRLSRGRRTRPASLAVVPSMTHSAVARKARAGSMPLCLL
-
Nucleotide Sequence: 627 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c3581120-3580494 Pseudomonas aeruginosa PA1R, complete genome
ATGGCAACACCCGCCTATATGTCCATCACCGGCACCAAGCAGGGCCTGATCACCGCCGGCGCCTTCACCG
AGGATTCGGTCGGCAACACCTACCAGGAAGGCCACGAGGACCAGGTGATGGTCCAGGGCTTCAACCACGA
AGTGATCATCCCGCGCGACCCGCAGTCCGGCCAGCCGACCGGCCAGCGCGTGCACAAGCCGGTGGTCATC
ACCAAGGTCTTCGACAAGGCCTCGCCGCTGCTGCTGGCCGCCCTGACCTCCGGCGAGCGCCTGACCAAGG
GAGATCCAGTGGTACCGCACCTCCGCCGCCGGCACCCAGGAGCACTACTACACCACCGTCCTGGAAGACG
CGATCATCGTCGACATCAAGGACTACATGCACAACTGCCAGGACCCGGGCAACGCCCACTTCACCCACCT
GGAAGACGTGCACTTCACCTACCGCAAGATCACCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCGAC
GACTGGCGCTCCCCGGTCGCCGGCTGAGCCGCGGCCGCCGCACGCGGCCAGCCTCGCTGGCCGTCGTGCC
CTCGATGACCCATAGCGCCGTGGCCAGGAAAGCCCGCGCCGGGTCGATGCCGCTTTGTTTGTTGTAG
 Primer design