SecReT6
Effector Protein ID: 558675278
SecReT6 ID873
T6SS typeA4a
Gene symbol-
Locus tagPA1S_gp3016
StrainPseudomonas aeruginosa PA1
Repliconchromosome [GenBank: NC_022808] [Browse all T6SS(s) in this replicon]
Location [Strand]3373983..3376220 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDU6AER8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 9.00E-08, Aligned region: 303..329
PLDc [PF00614], Evalue: 9.00E-08, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 2.30E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 2.30E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 2.30E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 2.30E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|558675278|ref|YP_008811986.1| hypothetical protein PA1S_gp3016 [Pseudomonas aeruginosa PA1]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAEIQRTLDSSE
AQGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVVVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVVVATLATSDPAPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHSDSELGIAQPNPDLARAMREELWGAHAYKLAETT
EENFKLWNQKMDKNWKQQRNGESLTTHLLRFWDVTTPYSPNFTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|558672313|ref|NC_022808.1|:c3376220-3373983 Pseudomonas aeruginosa PA1, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTATACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAGGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGTTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGAGTGCAGGCGCGAGTGCTGGTCTGGAGCAACCAACTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCGGTG
GACAACGAGGTGCTGCGACTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAGCGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGAG
GCCCAGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAAGTGCGCCTCGTCAATGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCGTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGCCCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCG
CAGGACGACGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATCTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGCCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
TGACCCTGCCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCGCCG
CCGCTGAAGGCGCGCTACAAACACATCTACGTGCACTCCAAGCTGCTGCTGGTGGACGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATAGCGACAGCGAATTGGGGATTGCCCAACCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGGGCACATGCTTATAAGTTGGCCGAAACGACC
GAAGAAAACTTCAAGCTGTGGAATCAGAAGATGGATAAGAACTGGAAGCAGCAGCGAAATGGTGAATCTC
TAACGACCCATTTATTGCGGTTCTGGGATGTCACCACACCCTATAGTCCCAATTTTACGGTGGACTGA
 Primer design