SecReT6
Effector Protein ID: 76809724
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_0291
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]298606..299214 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068
DescriptionTae2
UniProt IDQ3JXJ6
KEGG IDbpm:BURPS1710b_0291
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 202 a.a.     [Download]
>gi|76809724|ref|YP_331707.1| hypothetical protein BURPS1710b_0291 [Burkholderia pseudomallei 1710b]
MHTPARPMRARRANCTRRGICVELSRRLIVSRICPTIRFAWLVAAIRIPLIKTEGTMPYVSTHYSNNASA
PVGRWTCAPTSKLAPFDKTPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAPVKGNATIVAGTMIA
TFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVRQRRLRWGAHGRSNNGDNFYVVE
-
Nucleotide Sequence: 609 bp     [Download]
>gi|76808520|ref|NC_007434.1|:298606-299214 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGCATACGCCGGCACGGCCGATGCGCGCGCGACGCGCAAACTGCACGCGGCGCGGGATTTGTGTTGAAT
TGTCGCGGCGGTTGATCGTTTCGCGCATCTGCCCGACAATCCGGTTCGCTTGGCTGGTTGCGGCAATTCG
AATTCCGCTTATAAAAACCGAGGGAACCATGCCTTACGTGTCGACCCATTACTCGAACAACGCCAGCGCG
CCGGTCGGCCGCTGGACCTGCGCGCCGACTTCGAAGCTCGCGCCTTTCGACAAGACGCCGACGGGCAGCG
TCACGTCCGGCGTCGATCTGTGCGGCCAATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCT
CACCGGGCAATGGCGCAAGGGCGCGCCGGTGAAAGGCAACGCGACGATCGTCGCGGGCACCATGATCGCG
ACGTTCAACGCCGCCGGCAAGTACGACGGCCACGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCA
TCCTGGTGTACGACCAGTTCGTGACGCCGCCGACGCCGCAGCCGGTTCGGCAACGGCGCCTGCGCTGGGG
CGCGCATGGTCGGTCGAACAATGGGGATAACTTCTATGTCGTGGAGTAA
 Primer design