SecReT6
Effector Protein ID: 76810168
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_1771
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]1924245..1927085 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ3JTD1
KEGG IDbpm:BURPS1710b_1771
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-61, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 2.40E-61, Aligned region: 561..561
DUF2345 [PF10106], Evalue: 6.40E-41, Aligned region: 748..912
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 587..690
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 792..831
T6SS_Vgr [PF13296], Evalue: 8.10E-26, Aligned region: 827..866
Phage_base_V [PF04717], Evalue: 5.30E-12, Aligned region: 442..546
Protein Sequence: 946 a.a.     [Download]
>gi|76810168|ref|YP_333172.1| Rhs element Vgr protein [Burkholderia pseudomallei 1710b]
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDDGGFRLQLTALAEHPSLPLAQLIGA
PILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLDASVVEISEQVF
RRYARGVIAPAWRWALADAAKYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVL
ADSNQRFAPDEPEIVGFHQTSDDDPQGCIQHFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGE
DRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALRSEGRSTRRDLRPGLRFAIAHHPTLGVSDAFICLRVEH
SARANVDATVRSAIEQRLGAIASIAGAAPVPHGPASALNAALGADTHHGGSLMRDDAVYRNRFVALPAEQ
TYRPLAASGHGARMHPVAVMPGAQTAIVVGAGDPVHTDRDHRIRIQHHAQRGENAASRDDHPHAANAPAN
RGAGTWTRMMTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNAHAQHNAQAGGPSGST
GNAAAWFAGNAHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHVKQTQDN
RRQADRGYGAELATDAAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAALAHKQGAEPGGA
VPEAAGGAGAASASTGAAADKPLPAVDGIEQSREAIGATREGSGGDTAGGGGGGAIAWSKPHLVAHGEAG
LAAMSAKSHVWVSGTETVLSAGQDVQLTAKGKTSVVANHGISLYTQGAAGDGRPVAGRGIALHAASGAVS
VQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADFKAAAHQLTGP
KSAGASAQMPKSEPKLCEYKTRAADVAHEGTMKSAA
-
Nucleotide Sequence: 2841 bp     [Download]
>gi|76808520|ref|NC_007434.1|:1924245-1927085 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGTCGATCCCCACTGACGTTCTGCAAGCACTCTTCGGCGGCTGGTCGCAACACGACCGCTTTCTCTGGA
TCACGACGCCGCTCGGCGCGAACGCGCTCGTCGCGGAAAGCCTGCACGGCTGGGAGGCGCTCGACGATGG
CGGCTTCCGTTTGCAGCTCACCGCGCTCGCCGAGCATCCGTCGCTGCCGCTCGCGCAACTGATCGGTGCG
CCGATCCTGATCGAATGGCAGGCGCAGGAAGGGCGCGACGCGCGCCGGCCGTTCCACGGCCACGTGATCG
CCGCCGAGCTCGTCGGCTACAACGGCGGACTCGCACGCGTGCGGCTCGTCGTCGAGCCGTGGCTCACGCT
GTTGCGGCAGCGCGTCGACAGCTACAACTATCTGGACGCGAGCGTCGTCGAGATCAGCGAACAGGTGTTC
CGCCGTTACGCGCGCGGCGTGATCGCGCCCGCATGGCGATGGGCGCTCGCCGATGCGGCGAAGTACCCGA
AGCGCAGCTTGACCGCGCAAGCCGGCGAGTCCGATTTCGACTTCCTCGAGCGGCTCTGGGCGGAGGAGGG
CATCTTCTACTGGTTCGAGCACGAAGGCGACGCGCGCGCGTCGAGCCTCGGCAAGCACACGCTCGTGCTC
GCCGATTCGAATCAGCGCTTCGCGCCGGACGAACCGGAGATCGTCGGCTTTCATCAGACGAGCGACGACG
ACCCGCAAGGCTGCATCCAGCACTTCATGCACGCGCGGCGTTGGCGCATCGGCAGCGTCGCGCGCGCGAG
CTGGGATCACCGCAGCCTGTCGACGCGTCCGACGGGCGCGCGCGCGAACGGCGCGGTCGCGCCGGGCGAG
GATCGCGACGTCGCGGGCCCGTACGCATACCAGACGGGCGCGATCGGAGACCGGCGCGCGCAGCAGCAAC
TCGACGCCCAGCGCGTGGCCGCGCTGCGGAGCGAAGGCCGCAGCACGCGCCGCGATCTGCGGCCCGGGCT
GCGTTTTGCGATCGCGCATCATCCGACGCTCGGCGTATCGGATGCGTTCATCTGCCTGCGCGTCGAGCAT
TCGGCGCGCGCGAACGTCGATGCGACCGTGCGCAGCGCGATCGAACAGCGCCTCGGCGCGATTGCGTCGA
TCGCCGGCGCCGCGCCGGTGCCGCATGGCCCCGCGAGCGCGCTGAATGCGGCGCTCGGCGCCGATACGCA
TCACGGCGGATCGCTGATGCGGGACGACGCCGTCTATCGCAATCGCTTCGTCGCGTTGCCCGCCGAGCAG
ACGTATCGGCCGCTCGCCGCATCCGGCCATGGCGCGCGCATGCACCCGGTCGCCGTGATGCCGGGGGCGC
AGACGGCGATCGTCGTGGGCGCGGGCGATCCCGTTCACACCGACCGGGATCACCGGATTCGAATCCAGCA
CCACGCGCAGCGCGGCGAGAATGCGGCGAGCCGCGACGATCACCCGCATGCGGCGAACGCGCCGGCGAAC
CGTGGCGCGGGCACGTGGACGCGGATGATGACGCCCGTGGGCGGCGATAACTGGGGTGGGGTGAGCGTGC
CGCGCGTCGGGCAGGAAGTGTGGACCGAATGGCTCGAAGGCCAGCCCGACCGGCCGGTTGCGGTGGCCGC
GCTCTACAACGGCCGCGGCAACGCGCACGCGCAGCACAACGCGCAGGCGGGAGGGCCGAGCGGCAGCACC
GGCAATGCGGCCGCATGGTTCGCCGGCAATGCGCATGCGGCGGTGCTGACGGGTTTCAAGACGCAGGACA
TGAGCATGAGCCAGCAAGGCACGGGCGGCTATCGGCAATTCATGCTCGACGATACGGCGGGCCAGTCGAG
CGCGCGCCTGTACACGACGGACCGCAACAGCGGGCTCACGCTCGGGCACGTGAAGCAGACGCAGGACAAC
CGGCGCCAGGCCGATCGCGGCTATGGCGCGGAACTGGCGACGGATGCCGCCGGCGCGCTGCGCGGCGGCG
CGGGGCTCTTGATCAGCACGGCGCCCGGCGTGAGCCAGATGGATGCGAGCGCGCCGAGCCAGGTGCTCGC
TCAGCATCGACAGACGTTGCAAAGCCTCGCGGCGCTCGCGCACAAGCAGGGCGCGGAGCCGGGCGGTGCG
GTGCCCGAGGCGGCGGGCGGAGCGGGCGCGGCGTCGGCGTCGACGGGGGCGGCGGCGGACAAGCCTTTGC
CGGCCGTCGATGGCATCGAGCAGAGCCGTGAAGCGATCGGCGCGACGCGTGAAGGAAGCGGCGGCGATAC
GGCAGGCGGCGGGGGCGGCGGCGCGATTGCGTGGAGCAAGCCGCATCTCGTCGCACACGGCGAGGCGGGG
CTGGCCGCGATGTCGGCGAAGAGCCACGTGTGGGTGTCGGGTACCGAGACGGTGTTGAGCGCCGGACAGG
ACGTGCAATTGACGGCGAAGGGCAAGACGAGCGTCGTCGCGAATCACGGCATCTCGCTGTATACGCAGGG
CGCGGCGGGCGACGGGCGGCCGGTTGCCGGCCGGGGCATCGCGTTGCACGCGGCGTCCGGCGCGGTGAGT
GTGCAAGCGCAGAACGCCGGCAAGCTGAGCGCGAGCGCGCAGAAGGCGGTGACGCTCGCGAGCGCGCAAG
GCAGCGCGTCCGTGCAGGCGCAGCAGCGCGTCCTGCTGAGCGCGGCGAAGGCCTATCTGAAGATGGAAGG
CAACGACATCGTCGTCGGCGCGCCGGGGCGCGCGGATTTCAAGGCGGCGGCGCATCAGTTGACGGGGCCG
AAGAGCGCGGGGGCGTCAGCGCAAATGCCGAAGAGCGAACCGAAGCTGTGCGAGTACAAGACGCGCGCGG
CCGACGTTGCTCACGAAGGCACGATGAAGTCGGCGGCTTGA
 Primer design