SecReT6
Effector Protein ID: 76811211
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_3642
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]3968739..3969242 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDQ3JN46
KEGG IDbpm:BURPS1710b_3642
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-45, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|76811211|ref|YP_335007.1| hypothetical protein BURPS1710b_3642 [Burkholderia pseudomallei 1710b]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|76808520|ref|NC_007434.1|:c3969242-3968739 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCCGACAAGGACCACGAAG
GCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCGTCGACGGCGGG
CGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACG
GCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design