SecReT6
Effector Protein ID: 76811269
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_1768
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007434] [Browse all T6SS(s) in this replicon]
Location [Strand]1916256..1918664 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDQ3JTD4
KEGG IDbpm:BURPS1710b_1768
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 42..137
DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 285..409
Protein Sequence: 802 a.a.     [Download]
>gi|76811269|ref|YP_333169.1| hypothetical protein BURPS1710b_1768 [Burkholderia pseudomallei 1710b]
MSYRFASADRFDVNVVTKDEQDAILRRLHEDDGMACCKTLHIGIFFDGTRNNADRDRGARTESNVARLYA
AFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAV
LGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQL
KNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEP
RGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDING
PGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAA
QARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAE
VFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDD
DVWNHRQIQELKTKQASFERAHAAWKKRVEMGMPSLLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQ
ADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWD
QPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2409 bp     [Download]
>gi|76808520|ref|NC_007434.1|:1916256-1918664 Burkholderia pseudomallei 1710b chromosome I, complete sequence
ATGAGTTATCGTTTCGCATCCGCCGACCGATTTGATGTTAATGTCGTTACGAAAGACGAGCAGGACGCTA
TTTTGCGGAGGCTGCATGAAGATGACGGCATGGCTTGTTGTAAGACATTGCATATCGGAATCTTCTTTGA
TGGTACGCGTAACAACGCTGATCGGGATAGGGGGGCGCGAACGGAAAGCAATGTGGCACGGCTTTATGCC
GCTTTTCCAATAGATAAATATCACCAAGCGATTTACGTTGCTGGAGTTGGCACGCCTTTTGTCGAGCAGA
TTGGTGATTTCGGTGTTGGCTTACAGGCGGCCGCAGGAGCTGCGGCAGGTTGGGCGGGAGAGGGGCGAAT
TAACTGGGCTTTGCTTCGGATTCACGATATTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTG
TTAGGAAAGCGCTACGAGGAACTCGTAAAATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTG
GCGGAACGCCGCCTAAACCGGGAAGCTTCGGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCT
CAAGCTGATTGCTGCCGAACAGAATGGTGTCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTC
AAAAACGAGTTGGATTCGTCGAAGTGGAATGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGTAAGGTAT
TGCTCGATCGTCGTGCTCAGCTAAAAGCGCGCATCGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCA
ACGCATTCGGCTATACGTATTCGGCTTTTCGCGCGGTGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTT
GCTGACGCGCTTGACCCCGATTTCAGTTTGTGTGGAGTGCCGGTTTCATACGATTTTCTCGGTATCTTTG
ATACGGTCGCATCGGTCGGCATCGCTCAGAGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGG
GCGCAAGGAACTGATGGCCGTGCCGCATTATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCT
CGTGGATCATTTCCGCTCGACCTTATCGATTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTG
TTCACTCGGACGTCGGCGGCGGCTATGGGCCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACT
TTCGCAAGTCCCGCTGCTTGATATGTACCGGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGG
CCAGGTATCGGCGCGGACGTCATCGCTGCATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCT
ACGTAAAAAAGAGCGAGAACTATTATTACGAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTA
CGGCTTGTATCTCCGGTGGCGCAAGATGCGGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCG
CAGGCGCGCTATCCGCAAGATGCAGCGGATCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACG
ATTTGCTGGAGGTCGAGAAAGCTGGCGGCCCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATG
GGCCAGTGAGAATCCGAAAACGGCCGCCGTCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAG
GTTTTTGTTCCGGGGGTTAGCGCTGCGACGGTTCTATTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCC
AACTCAAGGAGAAGTGGGAGCAGTGGCTGCAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGC
GATCAGCGCACTCTACGACAACTACATGCACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGAC
GACGTGTGGAACCATAGGCAGATTCAGGAACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTG
CCTGGAAAAAGCGTGTCGAAATGGGCATGCCAAGCTTGTTGCAGGTTACACAGGCAATGGGCGTAGGTTC
CACAGGATGGGGGCCCGTCGGCGGGCTTCCGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAA
GCCGATCTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGA
ACGCGCCGACGGACAGCGCCGTGCTGACCGATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGG
CCGCGAGTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGAC
CAGCCGCGCGTGCCGACGGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAGCGCCAGGTCGACA
TGAAGGGCATCGGCGTACTGTTCCAATGA
 Primer design