SecReT6
Effector Protein ID: 76818674
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_A1140
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1422034..1422732 [+]
Productlectin
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDQ3JJF6
KEGG IDbpm:BURPS1710b_A1140
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 5.90E-11, Aligned region: 19..65
B_lectin [PF01453], Evalue: 5.90E-11, Aligned region: 121..159
Protein Sequence: 232 a.a.     [Download]
>gi|76818674|ref|YP_336297.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGG
YPTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVY
NKGQPVWSTGTSGNPGTYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPSPSLN
LPINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 699 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1422034-1422732 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGTCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGC
AGACCGACGGGCGGCTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGC
GCCGATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGC
TATCCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCT
ATCCGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGTCAATGGCTGCAGATCTTCAACAACGTCACTTA
CTACCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTAC
AACAAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCACCTACATGCTGGTGACGCCTG
TCGGCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCA
GTCGAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGTCGCCCTCGCTGAAC
CTGCCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA
 Primer design