SecReT6
Effector Protein ID: 76818982
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_A0207
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]310141..312906 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ3JM37
KEGG IDbpm:BURPS1710b_A0207
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-57, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 5.80E-42, Aligned region: 614..646
DUF2345 [PF10106], Evalue: 5.80E-42, Aligned region: 700..844
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 733..798
Phage_base_V [PF04717], Evalue: 9.80E-19, Aligned region: 462..546
Protein Sequence: 921 a.a.     [Download]
>gi|76818982|ref|YP_335366.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGV
LLGIPVSIRLITDRGQPHTVNAIISGVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQ
GDAPVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESS
VASGLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITL
TGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTF
ACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAG
DSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSG
IKTKEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAA
QGMLLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTGT
DGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAVAG
EGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKLLSASHQW
GGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDLVKDDAMR
IAKIDYLKPKL
-
Nucleotide Sequence: 2766 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c312906-310141 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGA
AGGCCTGATGACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTG
TTGCTCGGCATTCCGGTTTCGATCCGGCTCATTACCGACCGCGGACAGCCGCACACGGTGAACGCGATCA
TCAGCGGCGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGATGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAG
GGCGACGCGCCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCA
CGGTCCGCCTGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGCGCCCGGCAAGGCCGGGCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGGGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTGCGCACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAAGCCGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTG
ACGGGCGATCCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACG
ACATCTGGAACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCT
CGCGTGCGCGCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTC
GCGTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATC
TGCTCACGGGCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCCATTTCGGCGCATCGTTTCTGCCGCGAG
TCGGCATGGAAGTCCTTCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGC
ATCAAGACGAAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAA
CGGCCACGGGAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCG
CAAGGCATGCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCCGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGGCACG
GACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGGTGAACGTCACGCCGAAGACGC
ATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCTGCAACTGATGAGCGGCCAGCG
GCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCGGGGGTGCAGGCCGTGGCGGGC
GAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACGCGCAGAAGGGCGTCAAGATCA
CGACGAACGAGCACGAGGTGTTCGTGAGTGCGCCGAAGATTCGGCTCGTTGCCGAGGACGGCAGCTACCT
CGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCGGCGTCGCACCAGTGG
GGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGCCGACGGATCAGCGTTTCAAGC
TGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCGGTTCCGGATCACGCTGGACGA
CGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTGGTCAAGGACGACGCGATGCGT
ATCGCGAAGATCGACTATCTGAAGCCGAAGCTCTGA
 Primer design