SecReT6
Effector Protein ID: 76819188
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_A1584
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1930276..1932462 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDQ3JI62
KEGG IDbpm:BURPS1710b_A1584
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 2.50E-122, Aligned region: 398..707
Abhydrolase_6 [PF12697], Evalue: 0.00012, Aligned region: 20..43
Abhydrolase_6 [PF12697], Evalue: 0.00012, Aligned region: 208..294
DUF900 [PF05990], Evalue: 0.0053, Aligned region: 19..28
DUF900 [PF05990], Evalue: 0.0053, Aligned region: 195..265
PGAP1 [PF07819], Evalue: 0.0068, Aligned region: 20..25
PGAP1 [PF07819], Evalue: 0.0068, Aligned region: 231..284
Thioesterase [PF00975], Evalue: 0.009, Aligned region: 129..170
Thioesterase [PF00975], Evalue: 0.009, Aligned region: 240..341
Protein Sequence: 728 a.a.     [Download]
>gi|76819188|ref|YP_336741.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSNRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSDLRPGEYGRRYAAASAAKA
EGDSVRYAEVLGDPDMYLYQRAETGGTHSMFLPFYWGYRASDDEIAKISHPGEVKSRVADSDGNLMTRGQ
YQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPDRRYFVLAAA
RLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLKQQGQRCVDCIIMVDTPYSLQ
FTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPDKGGKHWITF
DERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTRLE
RDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGEQL
KPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQAFN
RGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLS
SENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTSRAFKQMKECKAFNRLDKHTRDFLDACSTYYR
TGQFPAEKFVMLTLPPLVTSELKAESKT
-
Nucleotide Sequence: 2187 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1930276-1932462 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGTCGAATCGGCCCGGCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCC
ACGGCGTCAACGATCCCGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCG
CTTGTCGCGAAGCGATCTGCGGCCGGGGGAGTATGGCAGGCGGTATGCGGCTGCGTCGGCGGCGAAAGCC
GAGGGCGATAGCGTTCGGTACGCGGAAGTGCTGGGCGATCCGGACATGTATCTGTATCAACGTGCGGAGA
CCGGCGGCACTCACAGCATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGATCGCGAA
GATCAGCCATCCGGGCGAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAG
TATCAGGACATCCACGGCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGA
CGAACAACATCCCGCAGATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAA
CGCGCTGGCCGGCAATACGATCTTCGCCGGCAAGTCGCCCGATCGCCGCTATTTCGTGCTGGCCGCGGCT
CGCCTGGCGAGCCTCATCCGGACCATTCGGGCCGTCCGGCCTTCCGCGCTCGCGCTGGAGCACGGCATGG
ATCCTCGACACGAAACGATCACCGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGC
GATGCTCAAGCAGCAAGGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAG
TTCACCCAGGACGGCAGCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGG
TGACGAGCGAGCCGCATACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCG
GGCCGGACAGAACTGGAGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTC
GACGAGCGCGACAACCGCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACA
AGGTGCGGGGGATCGGCACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGG
CAAAACGATGCCCGCGATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAG
CGCGACCAGGACGGCAGGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTC
GCGACCCGTTTCAGCGATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATC
CGGCAAGAACATGGCGCTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTG
AAACCGGCGTACGAGCCCGATCTGTACGGGGGCGAGGTTCAGAAAGGCGGACAGGTGCCCGGGCACGCCG
ATGTTGCCGGGTTGATGCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTT
CAAATGGAAAGACGTCGCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAAT
CGCGGGCGTCCGGTCGACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGC
TGTCGGCGGCCGCCACGGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGT
TCGCAAGCGCATGCGCACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGT
TCGGAGAACCATCGCTGGGTTACGGCGATGGATGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGG
ACTGGCGGCAGTTGTTGCTTTTGATGGCGGATTGGAAGATGACGTCTCGCGCGTTTAAGCAAATGAAGGA
ATGCAAAGCCTTCAACCGATTGGATAAACATACGCGTGATTTTTTGGACGCATGCTCAACGTACTACCGA
ACCGGTCAATTTCCGGCTGAGAAATTCGTGATGCTTACACTTCCGCCATTGGTTACCAGCGAACTAAAGG
CTGAAAGCAAAACATGA
 Primer design