SecReT6
Effector Protein ID: 76819556
SecReT6 ID91
T6SS typeA4b
Gene symbol-
Locus tagBURPS1710b_A0205
StrainBurkholderia pseudomallei 1710b
Repliconchromosome I [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]307887..310073 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDQ3JM39
KEGG IDbpm:BURPS1710b_A0205
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 4.90E-121, Aligned region: 398..707
Abhydrolase_6 [PF12697], Evalue: 0.00014, Aligned region: 20..43
Abhydrolase_6 [PF12697], Evalue: 0.00014, Aligned region: 208..294
PGAP1 [PF07819], Evalue: 0.0058, Aligned region: 20..25
PGAP1 [PF07819], Evalue: 0.0058, Aligned region: 226..284
DUF900 [PF05990], Evalue: 0.0059, Aligned region: 19..28
DUF900 [PF05990], Evalue: 0.0059, Aligned region: 196..265
Thioesterase [PF00975], Evalue: 0.0059, Aligned region: 129..169
Thioesterase [PF00975], Evalue: 0.0059, Aligned region: 239..341
Protein Sequence: 728 a.a.     [Download]
>gi|76819556|ref|YP_335364.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSDLRPGEYGRRYAAASAAKA
EGDSVRYAEVLGDPDMYLYQRAEAGGTHSMFLPFYWGYRASDNEIAKISHPGEVKSRVADSDGNLMTRGQ
YQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPERRYFVLAAA
RLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQGQRCVDCIIMVDTPYSLQ
FTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPDKGGKHWITF
DERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTRLE
RDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGEQL
KPAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQAFN
RGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLS
SENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKACVDYYK
TGRFPDEKYVPLTMPPLVTSELKVESKT
-
Nucleotide Sequence: 2187 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c310073-307887 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCGAATCGGCCGGGCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCC
ACGGCGTCAACGATCCCGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCG
CTTGTCGCGAAGCGATCTGCGGCCGGGGGAGTATGGCAGGCGGTATGCGGCTGCGTCGGCGGCGAAAGCC
GAGGGCGATAGCGTTCGGTATGCGGAAGTGCTGGGCGATCCGGACATGTATCTGTATCAACGTGCGGAGG
CCGGCGGCACTCACAGCATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGACAACGAGATCGCGAA
GATCAGCCATCCGGGCGAGGTCAAGAGCCGCGTGGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAG
TATCAGGACATCCACGGCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGA
CGAACAACATCCCGCAGATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAA
CGCGCTGGCCGGCAATACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTGGCCGCGGCT
CGCCTGGCGAATCTCATCAAGACCATTCGGACCATTCAGCCCTCCGCGCTCGCGCTCGAACATGGAATGG
ACCCTCAGCACGAAACGATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGC
GATGCTCAGGCAGCAAGGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAG
TTCACCCAGGACGGCAGCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGG
TGACGAGCGAGCCGCATACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCG
GGCCGGACAGAACTGGAGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTC
GACGAGCGCGACAACCGCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACA
AGGTGCGGGGGATCGGCACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGG
CAAAACGATGCCCGCGATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAG
CGCGACCAGGACGGCAGGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTC
GCGACCCGTTTCAGCGATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATC
CGGCAAGAACATGGCGCTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTG
AAACCGGCGTACGAGCCCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGCACGCCG
ATGTCGCCGGGTTGATGCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTT
CAAATGGAAAGACGTCGCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAAT
CGCGGCCGTCCGGTCGACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGC
TGTCGGCGGCCGCCACGGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGT
TCGCAAGCGCATGCGTACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTGCTCAGT
TCGGAGAACCATCGCTGGGTCACGGCGATGGATGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGG
ACTGGCGGCAGTTGTTGCTTTTGATGGCGGATTGGAAGATGACGCCGGACGTGTATCGCAATATCCAGAA
ATGCAAGAACTTTGAGCGCTTGGACGAACACACGCGCGAATTCGTGAAAGCGTGTGTCGACTACTACAAG
ACGGGCCGATTTCCCGACGAGAAGTATGTACCTCTCACCATGCCACCGCTCGTGACCAGCGAACTGAAGG
TTGAGAGCAAAACATGA
 Primer design