SecReT6
Effector Protein ID: 91212190
SecReT6 ID121
T6SS typeA2
Gene symbol-
Locus tagUTI89_C3196
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3108499..3108990 [+]
Productsecreted protein Hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDQ1R7L9
KEGG IDeci:UTI89_C3196
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|91212190|ref|YP_542176.1| secreted protein Hcp [Escherichia coli UTI89]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3108499-3108990 Escherichia coli UTI89 chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGATAACGTCAAGCTGGTCAGAGTAGCTCCGCT
GATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA
 Primer design