SecReT6
Effector Protein ID: 91212193
SecReT6 ID121
T6SS typeA2
Gene symbol-
Locus tagUTI89_C3199
StrainEscherichia coli UTI89
Repliconchromosome [GenBank: NC_007946] [Browse all T6SS(s) in this replicon]
Location [Strand]3114339..3116108 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAHW84487
DescriptionTle4
UniProt IDQ1R7L6
KEGG IDeci:UTI89_C3199
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 245..296
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 381..424
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 526..565
Abhydrolase_6 [PF12697], Evalue: 0.0028, Aligned region: 240..272
Protein Sequence: 589 a.a.     [Download]
>gi|91212193|ref|YP_542179.1| hypothetical protein UTI89_C3199 [Escherichia coli UTI89]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIR
TIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD
-
Nucleotide Sequence: 1770 bp     [Download]
>gi|91209055|ref|NC_007946.1|:3114339-3116108 Escherichia coli UTI89 chromosome, complete genome
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATAC
TTCATTAAATCAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAAT
CCATTTCATAAGCAAATTGCTGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGG
GAGATATTCCTGAAGCGCATTTAACGCAGGAAAATGTTCTTTGGAAAGGCTCATTATCAATGGGAAAAAA
AAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGTCTTGATTTAAATGAAGTTGGTAACATTAGA
ACTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATACTGACGACGGTGATACATATG
TTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTACCTCTTCGTGC
AGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTA
AAATGTCATACTCTGATTAA
 Primer design