SecReT6
Immunity Protein ID: 116053232
SecReT6 ID151
T6SS typeA4a
Gene symbol-
Locus tagPA14_67180
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]5995985..5996854 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDQ02ET1
KEGG IDpau:PA14_67180
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 42..49
Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 62..73
Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 75..106
Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 113..147
Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 149..180
Sel1 [PF08238], Evalue: 4.70E-10, Aligned region: 181..212
Protein Sequence: 289 a.a.     [Download]
>gi|116053232|ref|YP_793555.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAIGLWVVLCLAGVRVMANSKSFVCVNEKDHLPPLDSQTDAWYREAAALAKPDTLRPWGRIVELYSKAVE
RGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLDVPQGFYDMGAMIGNRAGVKNPATDGLTFLD
KAASLGNPPALTELGKLYIYVAKKKDLGLAYTHCAASQGYAPASYELGAYYKIVEHNFPKALVYYQVSVS
QGGKSAAFFLSRVFGSETPPASAMWYAPDEKLREAYYSIYKKLEADPDLRFPNLIEDYPLPPHPTQGYDA
DRPDWKPER
-
Nucleotide Sequence: 870 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c5996854-5995985 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTATTGGACTTTGGGTCGTGCTCTGTCTTGCAGGCGTCCGCGTGATGGCCAACAGCAAATCGTTTG
TCTGCGTTAATGAAAAAGACCATCTGCCGCCGTTGGATTCGCAAACCGATGCTTGGTACCGCGAAGCAGC
CGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGTAAGGCAGTGGAG
CGCGGCCATTGGAAGGCCATGCATAATTTGGCGAATCTTTATCGTACAGGGTGGCCCGGAGGAGTAGAAA
AAGATACGCAGAAGGCATTGGATCTCTATCAAAAGATGATAGATCTGGATGTGCCTCAGGGGTTCTATGA
TATGGGAGCAATGATTGGAAATCGCGCCGGGGTTAAAAACCCTGCAACTGACGGACTTACTTTCCTTGAT
AAGGCTGCTAGCCTAGGAAATCCGCCGGCACTAACTGAACTAGGTAAGCTTTATATATATGTGGCCAAAA
AAAAGGATTTGGGGTTGGCGTATACTCACTGTGCTGCTAGTCAGGGTTATGCGCCGGCTAGTTATGAGCT
GGGGGCGTATTACAAGATAGTAGAACACAATTTCCCAAAGGCACTGGTTTATTATCAGGTGTCAGTCTCT
CAGGGGGGCAAGAGTGCGGCTTTTTTCCTATCACGAGTCTTCGGAAGTGAGACTCCCCCTGCAAGTGCAA
TGTGGTACGCCCCCGACGAAAAGTTGCGAGAAGCGTATTATTCAATCTACAAAAAGCTTGAAGCTGACCC
CGACTTACGTTTCCCCAATCTGATAGAGGACTATCCTCTGCCTCCTCATCCCACCCAGGGCTACGACGCG
GACCGCCCAGACTGGAAGCCGGAGCGGTAA
 Primer design