SecReT6
Immunity Protein ID: 116053233
SecReT6 ID151
T6SS typeA4a
Gene symbol-
Locus tagPA14_67190
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]5996863..5997744 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDQ02ET0
KEGG IDpau:PA14_67190
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 45..52
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 68..77
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 79..109
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 117..151
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 152..183
Sel1 [PF08238], Evalue: 5.90E-13, Aligned region: 185..217
Protein Sequence: 293 a.a.     [Download]
>gi|116053233|ref|YP_793556.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MIRLMAIGIWAVLCLAAVPAMADSKPFVCVNEKDHLPPLDPQADAWYREAATLAKPDTLRPWPRIVDLYS
KAVERGHWKAMHNLASLYRTGWPGGVEKDTQKALDLYQKMIDLKVPQGFYDMAAMIGSRAGVKNPATDGL
TFLDKAASLGNPPALTELGRLYIYVAGQDELGLKYTNCAAGQGYAPANYELAMYYRLVAHNYPKAAGYYL
LAASQGNNDAAFFMSGVFDKTSPDVDRMWYAPDERLHKLYDGIYDQLSADPDLRFPNLIKDHPLPPHPTQ
GYDADRPDWKSGQ
-
Nucleotide Sequence: 882 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c5997744-5996863 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
GTGATTCGGCTAATGGCTATTGGAATATGGGCTGTACTTTGTCTCGCAGCAGTTCCCGCTATGGCTGACA
GCAAGCCTTTTGTCTGCGTTAACGAAAAGGACCATCTACCCCCTCTGGACCCGCAGGCCGATGCTTGGTA
TCGCGAAGCGGCGACCCTGGCCAAGCCCGATACCTTGCGTCCGTGGCCTCGTATCGTCGATCTATACAGT
AAGGCAGTTGAGCGTGGTCACTGGAAGGCTATGCATAACTTGGCGAGCCTCTATCGTACCGGTTGGCCAG
GCGGTGTGGAGAAGGATACTCAGAAAGCTCTAGATCTCTACCAGAAGATGATCGATTTGAAGGTTCCTCA
AGGTTTCTACGATATGGCGGCAATGATCGGGAGTCGCGCTGGCGTCAAGAATCCTGCGACTGATGGACTT
ACTTTTCTCGATAAGGCTGCAAGCTTGGGTAATCCACCAGCATTAACTGAGTTAGGAAGGCTATATATAT
ATGTTGCTGGTCAGGATGAGTTGGGGCTGAAATATACGAACTGTGCTGCAGGCCAGGGCTATGCTCCTGC
CAATTACGAACTGGCGATGTACTATCGTTTGGTGGCACATAACTACCCAAAGGCGGCAGGCTATTACCTT
CTTGCTGCAAGCCAAGGAAATAATGATGCTGCCTTCTTCATGTCCGGAGTTTTTGATAAGACTAGTCCCG
ATGTTGACAGAATGTGGTACGCCCCCGATGAGAGGCTACACAAACTATATGATGGTATTTACGACCAACT
TTCCGCTGATCCTGATTTGCGTTTTCCCAACTTGATAAAGGACCATCCTCTGCCTCCTCACCCGACCCAG
GGCTACGACGCAGATCGGCCCGACTGGAAATCGGGGCAGTGA
 Primer design