SecReT6
Immunity Protein ID: 116053234
SecReT6 ID151
T6SS typeA4a
Gene symbol-
Locus tagPA14_67200
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]5997741..5998610 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5087
DescriptionPA5087
UniProt IDQ02ES9
KEGG IDpau:PA14_67200
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 41..49
Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 62..73
Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 75..106
Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 113..147
Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 148..160
Sel1 [PF08238], Evalue: 9.50E-14, Aligned region: 181..212
TPR_7 [PF13176], Evalue: 0.0055, Aligned region: 39..51
TPR_7 [PF13176], Evalue: 0.0055, Aligned region: 76..111
TPR_7 [PF13176], Evalue: 0.0055, Aligned region: 197..206
Protein Sequence: 289 a.a.     [Download]
>gi|116053234|ref|YP_793557.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAIGLWAVLCLAGVPVMANSKPFVCANEKDHLPPLDPQADAWYREAAALAKPDTLRPWGRIVELYSKAVE
RGHWKAMHNLANLYRTGWPGGVEKDPQKALDLYQKMIDLDVPQGFYDMGAMIGNRAGVKNPATDGLTFLD
KAASLGNPPALTELGKLYIYVAKEKELGLAYTSCASSQGYAPASYELGSYYELVEHNYPKALRYYQVSVS
QGGRSAAFFLSRVFGKRTPPSSAMWYTPDEKLEKFYYSLYLQIDADPDLRFPNLVKDNPLPPHPVQGYDA
ARPDWKPGQ
-
Nucleotide Sequence: 870 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c5998610-5997741 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTATTGGACTTTGGGCCGTGCTCTGTCTTGCAGGCGTCCCCGTGATGGCCAACAGCAAACCATTTG
TCTGCGCTAATGAAAAAGACCATCTGCCGCCGTTGGATCCGCAAGCCGATGCTTGGTACCGCGAAGCAGC
AGCCTTGGCCAAGCCCGATACTCTGCGGCCCTGGGGCCGTATCGTCGAGCTTTACAGCAAGGCAGTGGAG
CGCGGTCATTGGAAGGCCATGCATAATTTGGCGAATCTTTATCGTACAGGGTGGCCCGGAGGAGTAGAAA
AAGATCCGCAGAAGGCATTGGATCTCTATCAAAAGATGATAGATCTGGATGTGCCTCAGGGGTTCTATGA
TATGGGGGCAATGATTGGTAATCGTGCCGGTGTTAAGAACCCTGCTACCGATGGTCTGACCTTCTTGGAT
AAAGCCGCTAGTTTGGGGAACCCGCCAGCACTGACCGAGTTGGGTAAACTCTATATTTATGTGGCCAAGG
AAAAGGAATTGGGGCTGGCGTATACCAGTTGTGCTTCCAGTCAAGGTTATGCTCCGGCGAGCTATGAGCT
TGGAAGCTACTATGAGTTGGTTGAGCATAATTATCCAAAGGCACTTAGATACTATCAAGTCTCCGTCTCT
CAAGGCGGCAGGAGTGCCGCCTTTTTTCTCTCGCGCGTCTTCGGAAAGAGGACGCCTCCTTCAAGTGCAA
TGTGGTATACGCCGGATGAAAAGCTTGAGAAATTCTACTACTCCCTCTATCTGCAAATTGATGCCGACCC
CGATCTTCGTTTTCCCAATTTGGTAAAAGATAACCCCTTGCCACCCCACCCCGTCCAGGGCTACGACGCA
GCTCGACCCGACTGGAAGCCGGGTCAGTGA
 Primer design