SecReT6
Immunity Protein ID: 116053235
SecReT6 ID151
T6SS typeA4a
Gene symbol-
Locus tagPA14_67210
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]5998619..5999494 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDQ02ES8
KEGG IDpau:PA14_67210
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 43..49
Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 66..75
Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 77..107
Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 115..149
Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 151..182
Sel1 [PF08238], Evalue: 3.40E-09, Aligned region: 183..214
TPR_7 [PF13176], Evalue: 0.0026, Aligned region: 41..52
TPR_7 [PF13176], Evalue: 0.0026, Aligned region: 78..113
TPR_7 [PF13176], Evalue: 0.0026, Aligned region: 152..160
TPR_7 [PF13176], Evalue: 0.0026, Aligned region: 199..210
Protein Sequence: 291 a.a.     [Download]
>gi|116053235|ref|YP_793558.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MRISIGLFIFLLSFGVPAMADSKPFICVNEKDHLPPLDPQADAWYREAVALAKPDALRPWGRIVDLYSKA
VERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLEVPQGFYDMGAMIGNRAGVMNPATDGLSF
LNKAASLGNPPALTELGKLYIYVAKKKDLGLAYTHCAASQGYAPASYELGAYYKIVEHNFPKALGYYQAS
VSQGGKSAALFISGVFDKASPDVDRMWYAPDEKLRKLYDGIYDKLAADPDFRFPNLIKDHPLPSHPTQGY
DADRPDWKPGQ
-
Nucleotide Sequence: 876 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c5999494-5998619 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCGAATCTCTATTGGTCTATTCATTTTCCTGTTGAGTTTCGGAGTTCCCGCTATGGCCGACAGTAAGC
CGTTCATCTGCGTTAATGAGAAAGACCATTTGCCACCTCTCGATCCCCAGGCCGATGCCTGGTATCGGGA
AGCAGTTGCGCTAGCTAAGCCTGACGCCTTGCGTCCTTGGGGACGTATTGTGGACTTATACAGTAAGGCA
GTTGAGCGTGGGCATTGGAAGGCGATGCATAATTTGGCGAATCTTTATCGCACAGGGTGGCCCGGAGGGG
TAGAAAAAGATACGCAGAAGGCATTGGATCTCTATCAAAAGATGATCGATCTGGAGGTGCCCCAAGGGTT
CTATGATATGGGAGCAATGATCGGCAATCGTGCAGGGGTCATGAATCCTGCAACTGACGGGCTTAGTTTT
CTTAATAAGGCTGCTAGCCTAGGAAATCCGCCGGCATTAACCGAGCTAGGTAAGCTCTATATATATGTGG
CCAAAAAAAAGGATTTGGGGTTGGCGTATACTCACTGTGCTGCTAGCCAGGGCTATGCGCCGGCTAGTTA
TGAGTTGGGGGCGTATTACAAGATAGTAGAGCATAATTTTCCAAAAGCATTGGGTTATTATCAGGCGTCA
GTCTCTCAGGGCGGAAAGAGTGCGGCTTTATTTATCTCCGGTGTTTTTGATAAAGCCAGTCCTGATGTCG
ATAGAATGTGGTACGCACCCGATGAGAAATTGCGCAAATTATATGATGGTATTTACGATAAACTTGCCGC
TGATCCTGATTTTCGTTTTCCCAACTTGATAAAGGACCATCCTCTACCTTCTCACCCGACCCAGGGCTAC
GATGCAGATCGGCCCGACTGGAAACCGGGGCAGTGA
 Primer design