SecReT6
Immunity Protein ID: 152983834
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3958
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]4099515..4099706 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityTsi5
DescriptionTsi5
UniProt IDA6V8C7
KEGG IDpap:PSPA7_3958
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|152983834|ref|YP_001349312.1| hypothetical protein PSPA7_3958 [Pseudomonas aeruginosa PA7]
MIKHYLLMTLVCIPLALLYVCLEWFFGNTWVTVGVFFGVLVVLRVGLYLYRRSKGIRDGYLDE
-
Nucleotide Sequence: 192 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c4099706-4099515 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGATCAAGCATTACCTGCTGATGACCCTCGTGTGCATTCCGCTGGCGTTGCTCTACGTCTGCCTGGAAT
GGTTCTTCGGCAACACCTGGGTGACCGTCGGGGTGTTCTTCGGCGTGCTCGTCGTGCTGCGCGTCGGCCT
GTACCTGTATCGCCGTTCGAAGGGGATCAGGGATGGCTACCTGGACGAGTGA
 Primer design