SecReT6
Immunity Protein ID: 152988085
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3980
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]4123960..4124193 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDA6V8E9
KEGG IDpap:PSPA7_3980
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|152988085|ref|YP_001349334.1| hypothetical protein PSPA7_3980 [Pseudomonas aeruginosa PA7]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEEALAQYSGLPPYDR
LVDDPAA
-
Nucleotide Sequence: 234 bp     [Download]
>gi|152983466|ref|NC_009656.1|:4123960-4124193 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGCTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAAGAGGCCTTGGCGCAATACAGCGGCCTGCCTCCCTATGACCGG
CTGGTCGACGACCCGGCCGCCTGA
 Primer design