SecReT6
Immunity Protein ID: 152988990
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_1641
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]1678905..1679342 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDA6V1U0
KEGG IDpap:PSPA7_1641
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|152988990|ref|YP_001347025.1| hypothetical protein PSPA7_1641 [Pseudomonas aeruginosa PA7]
MKTLALLIASLVLPACTVESGIEFDKPLVHPNGLVVERPVGFDARRTADGFRFDEGGDLRNPRRLELGRE
DTAPRAGLASRRLDSGEARYAIEEDAGGSAGSEYHLWAAKPAGGQWIVVSASEQSEDGEPAFALAWALLE
RARLQ
-
Nucleotide Sequence: 438 bp     [Download]
>gi|152983466|ref|NC_009656.1|:c1679342-1678905 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAAGACACTCGCCCTGTTGATCGCCAGCCTCGTCCTGCCGGCCTGCACCGTGGAGTCCGGGATCGAGT
TCGACAAGCCCCTGGTCCACCCGAACGGCCTGGTGGTGGAGCGCCCGGTCGGTTTCGACGCGCGACGGAC
CGCCGACGGTTTCCGCTTCGATGAAGGCGGCGACCTGCGCAATCCGCGGCGGCTGGAGCTCGGCCGCGAG
GACACGGCGCCGCGCGCCGGCCTGGCGAGCAGACGCCTGGACAGCGGCGAAGCGCGCTATGCGATCGAGG
AAGACGCCGGCGGCTCGGCCGGCAGCGAATACCACCTGTGGGCGGCCAAGCCGGCTGGCGGCCAGTGGAT
CGTGGTCAGCGCCAGCGAACAGAGCGAGGATGGCGAGCCGGCCTTCGCCCTGGCCTGGGCGCTGCTGGAG
CGGGCCAGGCTGCAATGA
 Primer design