SecReT6
Immunity Protein ID: 152989292
SecReT6 ID217
T6SS typeA3
Gene symbol-
Locus tagPSPA7_3447
StrainPseudomonas aeruginosa PA7
Repliconchromosome [GenBank: NC_009656] [Browse all T6SS(s) in this replicon]
Location [Strand]3573704..3574222 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDA6V6X2
KEGG IDpap:PSPA7_3447
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|152989292|ref|YP_001348807.1| hypothetical protein PSPA7_3447 [Pseudomonas aeruginosa PA7]
MKLLAGSFAAVFLSLSAQAADCTFTQLEIVPQLGSPNMFGGEDEHVRVMFSNEDPNDANPDAFPEPPVYL
ADLDSGNDCRIEDGGIWSRGGVFLSEDGRRVLMHEFSGSSAELVAYDSATCKVVHREDISGQRWAVDKDG
LRLGEKCSGESVASCAKIVKRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|152983466|ref|NC_009656.1|:3573704-3574222 Pseudomonas aeruginosa PA7 chromosome, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTGTCTTCCTGAGCCTTTCGGCCCAGGCTGCGGACTGTACCT
TCACCCAGCTGGAAATCGTGCCCCAGCTCGGCTCGCCGAACATGTTCGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAAGACCCCAACGACGCCAATCCCGACGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCTCGACAGCGGCAACGATTGTCGCATCGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TCAGCGAGGACGGGCGGCGCGTGCTGATGCATGAATTCAGCGGTTCCAGCGCCGAACTGGTGGCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGCGAGAAATGCTCGGGCGAGTCCGTCGCCAGCTGCGCGAAGATCGTGAAGCGCTCGCTCG
CACCGTTCTGCCAGACCGCAAAGAAATGA
 Primer design