SecReT6
Immunity Protein ID: 16763661
SecReT6 ID23
T6SS typeA3
Gene symbol-
Locus tagSTM0278
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. LT2
Repliconchromosome [GenBank: NC_003197] [Browse all T6SS(s) in this replicon]
Location [Strand]318153..318536 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDQ8ZRL5
KEGG IDstm:STM0278
PDB ID4HFF, 4J30, 4J32
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|16763661|ref|NP_459276.1| hypothetical protein STM0278 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 384 bp     [Download]
>gi|16763390|ref|NC_003197.1|:318153-318536 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 chromosome, complete genome
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA
 Primer design

Reference
(1) Benz J et al. (2013). Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium. PLoS One. 8(6):e67362. [PudMed:23826277] experimental in_silico
(2) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature