SecReT6
Immunity Protein ID: 205353489
SecReT6 ID303
T6SS typeA1
Gene symbol-
Locus tagSG2406
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]2472216..2472734 [+]
Productlipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDB5RCK1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 6.80E-41, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|205353489|ref|YP_002227290.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MKTFSLVALILLLCSCSTPHHDSTQAVKQFYTSWMTTFTNDVNPPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|205351346|ref|NC_011274.1|:2472216-2472734 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCCACGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATCCCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCCAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA
 Primer design