SecReT6
Immunity Protein ID: 241664839
SecReT6 ID349
T6SS typeA3
Gene symbol-
Locus tagRpic12D_3261
StrainRalstonia pickettii 12D
Repliconchromosome I [GenBank: NC_012856] [Browse all T6SS(s) in this replicon]
Location [Strand]3440936..3441391 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityRpic12D_3261
DescriptionTai3_RP
UniProt IDC6BHF3
KEGG IDrpf:Rpic12D_3261
PDB ID4HZ9, 4HZB
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 1.10E-34, Aligned region: 32..147
Protein Sequence: 151 a.a.     [Download]
>gi|241664839|ref|YP_002983199.1| hypothetical protein Rpic12D_3261 [Ralstonia pickettii 12D]
MTRFLSLLVAVVCALAVGSASAAQAAVSQNSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGR
LRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWK
IIKIDDTWEYR
-
Nucleotide Sequence: 456 bp     [Download]
>gi|241661625|ref|NC_012856.1|:3440936-3441391 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGACCCGCTTCCTTTCCCTGCTCGTTGCGGTGGTATGCGCCCTCGCGGTTGGGTCGGCATCCGCTGCAC
AGGCCGCCGTCTCGCAAAACTCGCCGGAGGCCGCAGCCATCTCGTTCTACACCTGGTTCATTCAGCATGA
TTCGGATCAAACGTATCCGCTGAGCGAGCCGGATATCGAGCGCTATGTCGCCACAGATACCGTTGGCCGG
TTGCGCAACGACTACGCACACGCCGGCCCGCCAAATGGCGTGGACTATTTTCTCAAGGTGCAGGACTACG
ATAGCCGCGACTGGCTTGCCCATATTCAAGTGCAACGCGCGTTGATGCTGGGCGATGTTGCAGTGGTGCC
GGTCTCTTTTGGCTCGCAAGACCCAGTGCATGTGCTGGTGTTTCTCAAGCGAGTGGATGCGACCTGGAAG
ATCATCAAAATCGACGACACCTGGGAGTACAGGTAA
 Primer design

Reference
(1) Dong C et al. (2013). Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3. Biochem J. 454(1):59-68. [PudMed:23730712] experimental in_silico
(2) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature