SecReT6
Immunity Protein ID: 336125206
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_00300
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015633] [Browse all T6SS(s) in this replicon]
Location [Strand]2840938..2841666 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0021
DescriptionTsiV2
UniProt IDF7YM29
KEGG IDvan:VAA_00300
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|336125206|ref|YP_004567254.1| hypothetical protein VAA_00300 [Vibrio anguillarum 775]
MLIDKDELEQLKANLHSSEVLYQWECVAFSERRGDIARWIIAVIAGFLLPSLFLVFGDIAFNSTEFWGFI
SFGLAGMSAGRYLLMPDHRYCYSLTQAGVHYTDQEVIPDAAYTFVRGFAWVGIVVCLLALAVVGPLAFVG
AGGFALLAFGLTNFHPTVHQKDVYFADQLIVFDPIKEKMVKLNSESRRHPRFSRTLFFSSFDEKTRFIEL
VKSVHNNVDYLPLRRVNDQYKHPIFNQELKEE
-
Nucleotide Sequence: 729 bp     [Download]
>gi|336122587|ref|NC_015633.1|:c2841666-2840938 Vibrio anguillarum 775 chromosome I, complete sequence
ATGTTAATTGATAAAGATGAGTTAGAGCAGTTAAAGGCAAATTTACACAGCAGTGAGGTTTTGTATCAGT
GGGAATGTGTGGCATTTTCAGAGCGACGAGGTGATATCGCTCGTTGGATTATTGCCGTCATTGCAGGCTT
TTTGCTTCCCTCACTATTTCTTGTGTTCGGGGATATTGCTTTTAACAGTACTGAGTTTTGGGGGTTTATC
AGCTTTGGCTTGGCGGGCATGTCGGCGGGAAGGTATCTTTTGATGCCCGACCACCGCTATTGTTACAGCT
TAACGCAAGCGGGTGTGCATTATACCGATCAAGAAGTGATCCCGGATGCGGCCTACACTTTTGTACGCGG
TTTTGCTTGGGTGGGGATTGTGGTCTGTTTGCTAGCCTTAGCCGTCGTTGGTCCGTTAGCGTTTGTTGGT
GCAGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCATCCCACCGTACATCAGAAAGATGTTT
ACTTTGCTGACCAATTGATTGTTTTTGATCCGATCAAAGAAAAGATGGTGAAATTGAATTCCGAAAGCAG
AAGACATCCTCGATTTAGTAGAACACTTTTTTTTAGTTCCTTTGATGAAAAAACACGTTTTATTGAGCTC
GTGAAGAGTGTTCATAATAATGTCGACTATCTTCCGTTACGGCGAGTTAATGATCAGTACAAGCATCCTA
TCTTTAATCAAGAATTAAAAGAGGAATAG
 Primer design