SecReT6
Immunity Protein ID: 336126183
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_01026
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]890093..890827 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVC1419
DescriptionTsiV1
UniProt IDF7YRP6
KEGG IDvan:VAA_01026
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|336126183|ref|YP_004578139.1| hypothetical protein VAA_01026 [Vibrio anguillarum 775]
MKFIANTNRKKRISIIVLFIALFFLGSDYYQTSQPNILGDEPDESYITISGKKPIDAYLEVWTHFWVTGD
ECEAYSYDLFGQKSHKGGKISQKITHNFAKDDSRYEFRIPYQTYKNEQNCIVELRDFSIQAYNKFDTVGF
AQLRVSPAGNEYYNRSIELGSSIEAKNCRARYYEDLDEWSTGLACSFYTNGKMKDKKDLVEFNAYTAYYD
FSKFNNDTVIHYDILAGENYRSEPLVQEQVAVAQ
-
Nucleotide Sequence: 735 bp     [Download]
>gi|336125405|ref|NC_015637.1|:890093-890827 Vibrio anguillarum 775 chromosome II, complete sequence
GTGAAATTTATCGCTAATACTAATAGGAAAAAAAGAATATCAATTATTGTACTATTCATCGCATTATTTT
TCCTTGGGTCTGATTATTACCAGACTTCTCAACCGAATATTTTGGGTGATGAACCTGATGAGTCCTATAT
TACTATATCAGGCAAAAAGCCTATAGATGCTTATTTAGAAGTTTGGACTCATTTTTGGGTGACAGGAGAT
GAGTGCGAGGCTTATTCCTACGATTTATTTGGTCAAAAATCCCATAAAGGAGGAAAGATAAGCCAAAAAA
TTACGCATAATTTTGCTAAAGATGATTCACGTTATGAATTTAGGATCCCTTACCAAACGTATAAAAATGA
ACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATTCAAGCATACAACAAATTTGATACTGTTGGTTTT
GCCCAGTTACGAGTTTCACCAGCAGGCAATGAATATTATAATAGATCAATTGAGCTTGGTTCTTCTATTG
AAGCAAAAAACTGTAGAGCAAGATATTACGAAGACTTAGATGAATGGTCTACAGGCTTGGCTTGCAGTTT
TTATACTAATGGGAAAATGAAAGATAAAAAAGATTTAGTCGAATTTAACGCTTACACCGCCTACTACGAT
TTCTCGAAATTTAATAACGACACTGTGATTCATTACGATATTTTAGCCGGTGAGAATTACCGCTCTGAGC
CGTTAGTGCAAGAACAAGTCGCTGTAGCGCAATAA
 Primer design