SecReT6
Immunity Protein ID: 378443724
SecReT6 ID550
T6SS typeA3
Gene symbol-
Locus tagSTMMW_02831
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. D23580
Repliconchromosome [GenBank: NC_016854] [Browse all T6SS(s) in this replicon]
Location [Strand]318124..318507 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDC9X7B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|378443724|ref|YP_005231356.1| hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 384 bp     [Download]
>gi|378443454|ref|NC_016854.1|:318124-318507 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA
 Primer design