SecReT6
Immunity Protein ID: 379741213
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_06580
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016944] [Browse all T6SS(s) in this replicon]
Location [Strand]1513561..1514304 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVC1419
DescriptionTsiV1
UniProt IDH8JY25
KEGG IDvci:O3Y_06580
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|379741213|ref|YP_005333182.1| hypothetical protein O3Y_06580 [Vibrio cholerae IEC224]
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGD
ECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGF
AQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDF
SKFNNDTVIHYDILAGENYRSEPLSSAQKTAVVSDDN
-
Nucleotide Sequence: 744 bp     [Download]
>gi|379739908|ref|NC_016944.1|:1513561-1514304 Vibrio cholerae IEC224 chromosome I, complete sequence
ATGAAGTTATTGAATAATCTTGCAATAAAAAAGCTAATCTCAGTTGTTGTACTATTCATTGCATTATTTT
TTCTTGGGTATGACTATTACCAGACTTCTCAACCTAATATTTGGGGTGATGAACCTGATGAGTCCTATAT
TACTATATCAGGCAAAAAGCCTATAGATGCTTATTTAGAAGTGTGGACTCATTTTTGGGTGACAGGAGAT
GAGTGTGAAGCTTATTCCTACGATTTATTTGGTCAAAAAGCCCATCAAGGAGGAAAAATAAGCCAGAAGA
TTACGCATGATTTTGCTAAAGATGGTTCAAATTTTGAATTTAGAATTCCTTACCAAACGTATAAGAACTC
ACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATACAAGCTCATAATGATTTTGATACCGTAGGTTTT
GCTCAGTTGCGATTTTCTCCAGCAGGCAGAGAATATTACAATCGAGAGGTTGATCTAAACTCATTGATTA
CAGCAGATAATTGCAATAGTGATATATTTAAAAGTATAAGAAAAGAGTGGGCAGGAGCCATTGGTTGTCA
TTTTTATGTCGATGGAAAGAAAAAGACTAAAGATGAAGAATTCAACGCTTACACCATCTACTACGATTTT
TCGAAATTCAATAATGACACCGTGATTCATTACGATATTTTAGCCGGTGAAAACTATCGGTCAGAGCCTT
TGTCCTCAGCTCAAAAGACAGCAGTGGTATCTGATGATAATTAA
 Primer design