SecReT6
Immunity Protein ID: 379743477
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_13593
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]26652..27380 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0021
DescriptionTsiV2
UniProt IDH8K020
KEGG IDvci:O3Y_13593
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 242 a.a.     [Download]
>gi|379743477|ref|YP_005334529.1| hypothetical protein O3Y_13593 [Vibrio cholerae IEC224]
MLIDKNELEQLKVKLHSSEVIYQWDSVAYGERRSEIFRVFGAISAGIVPLWPFIFFADIQFNSKEFWGFI
CFSLAGMAAARYLFMPDHRYCYSLTQAGIYYTDQEVIPDAAYTFVRGFAWVGIAVCLLALAVVGPLAFVG
AGGFALLAFGLTNFHPTVHKKEVYFADQLIVFDPIKEKMVDLNTDSTDEPWFDRRLFFSSLDEKTHFIEL
VKSIHNNVDYLPLQRVNDQYKHPIFNQELKEE
-
Nucleotide Sequence: 729 bp     [Download]
>gi|379743460|ref|NC_016945.1|:26652-27380 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGTTAATTGATAAAAATGAGTTAGAGCAGTTAAAGGTAAAATTACACAGCAGTGAGGTTATTTATCAAT
GGGATAGTGTGGCTTACGGAGAGAGAAGATCTGAAATATTTCGCGTTTTTGGGGCAATCTCTGCTGGTAT
TGTTCCCCTTTGGCCATTTATTTTTTTTGCAGATATTCAATTTAATAGTAAAGAGTTTTGGGGATTTATC
TGCTTTAGTCTGGCGGGCATGGCTGCTGCCAGATATCTTTTTATGCCCGACCACCGTTATTGCTACAGTT
TAACGCAAGCGGGGATTTATTATACGGATCAAGAAGTGATCCCAGATGCGGCCTACACTTTTGTGCGTGG
TTTTGCTTGGGTGGGGATTGCGGTCTGTTTGTTAGCCTTAGCCGTCGTTGGCCCGTTAGCGTTTGTCGGT
GCGGGCGGTTTTGCCCTGCTGGCCTTTGGTTTGACCAACTTCCACCCCACCGTACATAAGAAAGAGGTTT
ACTTTGCTGACCAATTGATTGTTTTTGATCCCATCAAAGAAAAGATGGTGGATTTAAATACAGATAGCAC
AGATGAACCATGGTTTGACAGACGGCTATTTTTTAGTTCACTTGATGAGAAGACGCATTTTATTGAGCTC
GTGAAGAGTATTCATAATAATGTCGACTATCTTCCGTTACAGCGAGTTAACGATCAGTACAAGCATCCAA
TCTTTAATCAAGAATTAAAAGAGGAATAG
 Primer design