SecReT6
Immunity Protein ID: 379743716
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_14798
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]305840..306190 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0286
DescriptionTsiH
UniProt IDH8JZZ9
KEGG IDvci:O3Y_14798
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|379743716|ref|YP_005334768.1| hypothetical protein O3Y_14798 [Vibrio cholerae IEC224]
MKKIIKWFAILLVSTCLAVVLLATFLFKFEYSVPNAQIIGQMIWFPEPTATGLSIVENKHPIYTIRITCG
SPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN
-
Nucleotide Sequence: 351 bp     [Download]
>gi|379743460|ref|NC_016945.1|:305840-306190 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGAAAAAAATCATAAAGTGGTTTGCAATCTTACTGGTATCAACCTGTCTTGCCGTAGTGCTCTTGGCTA
CGTTTCTTTTTAAATTTGAATATTCGGTACCAAATGCTCAGATTATTGGACAAATGATTTGGTTCCCAGA
GCCCACAGCAACGGGTCTCAGTATTGTAGAGAATAAACATCCTATCTATACGATTCGTATAACGTGTGGC
TCTCCGGATAATATTTGCCATGAAGGCCTATTTGAGTACAAAGGGAACACACTAAGCAAAATTGAGATAA
GAGATTTTGCTAGCTATTTAGGTGAAGAAATCACCTTAACGAATGGTGAAACCTTAGAACCTATGAATTG
A
 Primer design