SecReT6
Immunity Protein ID: 386590160
SecReT6 ID621
T6SS typeA3
Gene symbol-
Locus tagSU5_0917
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1058874..1059299 [+]
Productputative cytoplasmic protein
immunity typeProtein
Homologous immunitySTY0301
DescriptionTai2_TY
UniProt IDI0A5M9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|386590160|ref|YP_006086560.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MQKPILLLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGRLWEIDPEDNRRGIWFSCSYGQWVVLLARKVQGTVATCWSPDVLPAKLIC
K
-
Nucleotide Sequence: 426 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1058874-1059299 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGCAGAAGCCTATTTTATTGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCGTCTGTGGG
AGATAGACCCGGAGGATAATCGCCGGGGGATCTGGTTCTCATGTAGTTATGGACAGTGGGTTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTCGCGACATGCTGGAGCCCGGATGTCTTACCGGCAAAATTGATTTGT
AAATAA
 Primer design