SecReT6
Immunity Protein ID: 386590163
SecReT6 ID621
T6SS typeA3
Gene symbol-
Locus tagSU5_0920
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1060845..1061177 [+]
Producttype VI secretion system-associated protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDI0A5N2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|386590163|ref|YP_006086563.1| type VI secretion system-associated protein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIA
KKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 333 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1060845-1061177 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGCTGGTATGGCAGCCATCCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAA
AAAATTGGGCGCTGAGTCATTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGC
TACGGCCAGTGCTTACCTTGAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCG
AAAAAATATTCAGGGTTGAAATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATT
TTATCCATGACAGGGAATTAAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA
 Primer design