SecReT6
Immunity Protein ID: 386592185
SecReT6 ID621
T6SS typeA3
Gene symbol-
Locus tagSU5_02971
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]3220150..3220668 [+]
ProductPutative lipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDI0ABF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 2.10E-41, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|386592185|ref|YP_006088585.1| Putative lipoprotein [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRD
ADKGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|386589256|ref|NC_017623.1|:3220150-3220668 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACATCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGGTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCAA
AAGTCGCGCCGGAATATAAGAAGCATTAA
 Primer design