SecReT6
Immunity Protein ID: 409248696
SecReT6 ID767
T6SS typeA3
Gene symbol-
Locus tagSENTW_0236
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]21826..22251 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY0301
DescriptionTai2_TY
UniProt IDE8ZXW7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|409248696|ref|YP_006884536.1| hypothetical protein SENTW_0236 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGRLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
-
Nucleotide Sequence: 426 bp     [Download]
>gi|409248675|ref|NT_187073.1|:21826-22251 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGCAGAAGCCTATTTTATCGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCGTCTGTGGG
AGATAGACCCGGAGGATAATCGCCGGGGGATCTGGTTCTCATGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTCGCGACATGCTGGAGCCCGGATGTCTTACCGGCAAAATTGATTTGT
AAATAA
 Primer design