SecReT6
Immunity Protein ID: 409248700
SecReT6 ID767
T6SS typeA3
Gene symbol-
Locus tagSENTW_0240
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]23747..24130 [+]
Productputative periplasmic protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDE8ZXX1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|409248700|ref|YP_006884540.1| putative periplasmic protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MDTAVKWLILVTFSISGMLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYL
EYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 384 bp     [Download]
>gi|409248675|ref|NT_187073.1|:23747-24130 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
GTGGATACTGCCGTGAAATGGTTAATATTAGTTACTTTCAGCATAAGTGGAATGCTGGTATGGCAGCCAT
CCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAAAAAATTGGGCGCTGAGTCA
TTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGCTACGGCCAGTGCTTACCTT
GAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCGAAAAAATATTCAGGGTTGA
AATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATTTTATCCATGACAGGGAATT
AAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA
 Primer design