SecReT6
Immunity Protein ID: 409250981
SecReT6 ID767
T6SS typeA3
Gene symbol-
Locus tagSENTW_2500
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187107] [Browse all T6SS(s) in this replicon]
Location [Strand]958..1476 [+]
Productputative lipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDE9A4B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 2.10E-41, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|409250981|ref|YP_006886787.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLGTESTPIHLEVYTRWEEGRWKIYRVRD
ADKGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|409250980|ref|NT_187107.1|:958-1476 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGAGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGGCACAGAGTC
AACGCCCATTCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAAGCCTGGTCAGCAA
AAGTCGCGCCGGAATATAAGAAGCATTAA
 Primer design