SecReT6
Immunity Protein ID: 478477652
SecReT6 ID748
T6SS typeA1
Gene symbol-
Locus tagG655_07270
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]1574521..1575219 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3488
DescriptionTli5
UniProt IDM9RXY7
KEGG IDpsg:G655_07270
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 232 a.a.     [Download]
>gi|478477652|ref|YP_007708303.1| hypothetical protein G655_07270 [Pseudomonas aeruginosa B136-33]
MEAKIPLAKIYEHDLGIPDSHILGSKNIPFHVLLWRNQRVYYFTFSKPTENSAQRIKDLIARFRTRELYE
VPNEPGICFPYGFIADDGKTAYELKNSLRFTRTPNVIFSLLTASANDPWQTRPTSGLYDSDFRPGYDRQK
WKKSALLDSLHIGKRLAAFEGWRLDPRPDSGERERAWFGLAHTGGTLDPLVAIQVQTFQKGTDDLTDYTP
PPEEVLPRLKALSQSIEQRLAR
-
Nucleotide Sequence: 699 bp     [Download]
>gi|478476202|ref|NC_020912.1|:c1575219-1574521 Pseudomonas aeruginosa B136-33, complete genome
ATGGAGGCCAAGATTCCTCTCGCCAAGATCTACGAACACGATCTCGGCATCCCTGACTCCCATATCCTTG
GCAGCAAGAATATCCCCTTCCATGTCCTGCTCTGGCGCAACCAGCGGGTCTACTACTTCACCTTCTCCAA
GCCGACCGAGAACTCCGCCCAGCGCATCAAGGACCTAATCGCCCGCTTCCGCACCCGCGAGCTTTACGAA
GTGCCGAACGAACCGGGCATCTGCTTCCCCTACGGCTTTATCGCCGACGACGGCAAGACCGCCTACGAAC
TGAAGAACAGCCTGCGTTTCACCCGCACGCCCAACGTGATCTTCAGCCTGCTCACCGCCTCGGCCAACGA
TCCCTGGCAGACCCGTCCCACCAGCGGCCTCTACGACAGCGACTTCCGTCCCGGCTACGACCGGCAGAAA
TGGAAAAAAAGCGCGCTGCTCGACAGCCTCCACATCGGCAAGCGCCTGGCCGCCTTCGAAGGCTGGCGCC
TCGACCCGCGCCCCGACTCCGGCGAACGGGAACGCGCCTGGTTCGGCCTGGCCCATACAGGCGGCACCCT
CGATCCGCTGGTAGCGATCCAGGTGCAGACCTTCCAGAAAGGCACCGACGACCTCACCGACTACACCCCG
CCCCCCGAAGAAGTACTGCCCCGCCTGAAGGCCCTGAGCCAAAGCATCGAGCAGCGGCTGGCGCGCTGA
 Primer design