SecReT6
Immunity Protein ID: 501680511
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c30630
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]3419075..3419545 [-]
Productputative lipoprotein
immunity typeProtein
Homologous immunityPFL_3036
DescriptionTgi2
UniProt IDR4RKD9
KEGG IDpprc:PFLCHA0_c30630
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 156 a.a.     [Download]
>gi|501680511|ref|YP_008000337.1| putative lipoprotein [Pseudomonas protegens CHA0]
MLKLKSPSWVLGLSLACTTLVACATDSLQPARIKDSGLTREQAEQVLRVALKHQDYQLQRPGVFIDGDLQ
DENGKPPHPGYYDFSLGYNDPKAGATEYWGLFSVSLNTGDTWEINSCKRLDGAELRALQRRVMARTGKSL
ADEKSQREGLGCEDQQ
-
Nucleotide Sequence: 471 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c3419545-3419075 Pseudomonas protegens CHA0, complete genome
GTGCTGAAACTCAAGAGTCCTTCCTGGGTGCTTGGCCTGTCCCTGGCCTGCACCACACTGGTGGCCTGCG
CCACCGATAGCCTGCAGCCGGCGCGGATCAAGGACAGCGGCCTGACCCGCGAACAGGCGGAGCAGGTCCT
GCGGGTGGCCCTCAAGCACCAGGACTATCAGTTGCAGCGCCCCGGGGTGTTCATCGACGGCGACCTGCAG
GACGAAAACGGCAAGCCGCCCCATCCCGGGTACTACGACTTCAGCCTCGGCTACAACGACCCCAAGGCCG
GGGCCACCGAGTACTGGGGCCTGTTCTCGGTCAGCCTGAACACGGGCGATACCTGGGAAATCAACAGCTG
CAAGCGCCTTGATGGCGCCGAGCTGCGAGCCTTGCAGCGGCGGGTCATGGCCCGCACCGGCAAGAGCCTG
GCGGATGAAAAAAGCCAGCGCGAGGGCCTGGGCTGCGAAGACCAACAATAA
 Primer design