SecReT6
Immunity Protein ID: 501682869
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c54530
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6071752..6072201 [+]
Productputative periplasmic protein
immunity typeProtein
Homologous immunityPFL_5499
DescriptionTai3
UniProt IDR4RFK9
KEGG IDpprc:PFLCHA0_c54530
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 8.80E-38, Aligned region: 27..144
Protein Sequence: 149 a.a.     [Download]
>gi|501682869|ref|YP_008002695.1| putative periplasmic protein [Pseudomonas protegens CHA0]
MRMLFCSLLAAVAMHQSVALADCASSPKPATQAFYSWYLQTFSEDKDPLTDNVAEMKKYVSDSLITKIKK
QMASPDGLEEDYFLKAQDYMDEWLTQIKVSEPQVQGSSAKEQVTLGNTPDTTQIVDVRMIKDKGCWKIDE
VISTADQSD
-
Nucleotide Sequence: 450 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6071752-6072201 Pseudomonas protegens CHA0, complete genome
ATGAGAATGCTGTTTTGCTCGCTGCTGGCAGCGGTCGCGATGCATCAGTCGGTCGCCCTGGCCGACTGCG
CCAGTTCGCCAAAGCCCGCAACCCAGGCGTTTTATAGCTGGTACCTGCAAACCTTCAGCGAAGACAAGGA
TCCGTTGACCGACAACGTGGCGGAAATGAAGAAGTACGTCTCCGACTCGCTGATCACCAAGATCAAGAAA
CAGATGGCCAGCCCCGACGGCCTGGAAGAGGACTACTTCCTCAAGGCCCAGGACTACATGGATGAGTGGC
TGACCCAGATCAAGGTCAGCGAACCACAAGTCCAGGGCTCCAGCGCCAAGGAGCAAGTGACGTTGGGCAA
CACCCCGGACACCACCCAGATCGTCGATGTGCGGATGATCAAGGACAAGGGCTGCTGGAAGATCGATGAA
GTGATTTCCACCGCCGACCAGAGCGATTGA
 Primer design