SecReT6
Immunity Protein ID: 525960170
SecReT6 ID827
T6SS typeA1
Gene symbol-
Locus tagM636_14760
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1378180..1378773 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityVP1416
DescriptionVP1416
UniProt IDS5JCH7
KEGG IDvpk:M636_14760
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 197 a.a.     [Download]
>gi|525960170|ref|YP_008316301.1| hypothetical protein M636_14760 [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MISDINEEYYVLMCGSGKVPSPYVSCSKSHYLIFQEPMSLKMPIRIESAAEAQEKVPLIEAMAAPSDPVL
SGRITQVLNYFDLYKVQLLPAIYTHNDDSEHSYSVLVVDNDIDAYDFDNGLYIERLDDGEVGNPRNCRLD
PEKLSKIPLEKRYIFKIRGMMDYLVHKTIAESLVALNASGLHLVPVLEWDIGFGMKI
-
Nucleotide Sequence: 594 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1378773-1378180 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGATTTCAGATATTAATGAAGAGTATTATGTACTTATGTGTGGGTCTGGTAAAGTACCTTCTCCTTATG
TTTCTTGTAGTAAAAGCCACTATTTGATTTTCCAAGAACCTATGTCACTTAAAATGCCAATCCGGATAGA
GTCAGCAGCTGAAGCCCAAGAGAAAGTTCCATTAATCGAAGCTATGGCTGCCCCGAGTGATCCTGTACTT
TCAGGTAGAATAACACAAGTCCTCAACTACTTTGATCTTTATAAAGTTCAATTGCTCCCAGCTATATATA
CCCATAATGATGATAGCGAGCACTCTTATTCAGTCTTAGTTGTTGATAACGATATTGATGCTTACGATTT
TGATAACGGCCTATATATTGAGCGTTTGGATGATGGTGAGGTTGGAAACCCAAGAAACTGTCGACTTGAC
CCCGAAAAACTTTCAAAAATCCCGTTAGAAAAACGTTATATTTTTAAAATACGGGGCATGATGGATTATT
TAGTCCACAAAACAATTGCCGAATCTCTAGTCGCATTGAATGCAAGTGGACTTCACTTAGTTCCAGTATT
GGAATGGGACATTGGTTTTGGAATGAAAATTTAA
 Primer design